KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0582Help
Entry
Cabther_A0582     CDS       T01629                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:685362..686858
Genome map
AA seq 498 aa AA seqDB search
MALPATFGELKNSPWGDPARWRRSVKDEMRANLIAKLERGEKVFPGIVGYEDTVEPHLIN
AILSRHNLILLGRRGQAKSRILRSLTSLLDEVMPIVAGSEINDNPFAPISAYAQRVLDEQ
GDATPIAWRTRAERYIEKLATPDVTIADIIGDIDPIKAAKSGNLLSDETTMHFGLLPRAN
RAIFAINELPDLAGKIQVGLFNIMQEGDVQIKGFPVRLKLDVALVFSANPEDYTARGKII
TPLKDRIGSEILTHYPQTVEEGVRITAQEAWTDRPSRAPIHIPKFIREIVETIAFVARED
QRIDRRSGVSQRLPISLLENVVSSAERRALRHHETIIVPRISDIYASLPAITGKIELEYE
GEQVGAERIARELIRTACGRVYDNYLALAETGRIVEWFNQGHSLKVSEADSSAAILEKMR
AIRTLIEVAEMGGYAEGRTPAHLVSAAELILEGLHAQRKVSRSEERGYGKAAPADRRRGR
RGDDEDDFSNWGGFGSLN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcctgctactttcggtgaactcaaaaacagcccgtggggtgatcccgcccgg
tggcgtcgctcggtcaaggacgaaatgcgcgccaacctcatcgccaagcttgaacgtggc
gaaaaagtcttccccggcattgtagggtatgaagatactgttgagcctcatctgatcaac
gccatcctgtcacgccacaatctgatcctgctgggacggcgagggcaggcgaaaagtcgc
attttgcgttccctgaccagcctgctcgatgaggtcatgcccatcgtggccggctcggag
atcaacgacaacccctttgcgcccatcagcgcctacgcgcagcgcgtcctggacgaacag
ggggatgcgacgcccattgcctggcggacacgcgcggaacggtacatcgagaaactggcc
acgccggacgtgaccatcgccgacatcatcggggacattgaccccatcaaggcggcaaag
agcggcaacctgctcagcgacgagaccaccatgcactttggtcttctgccccgggccaac
cgcgccatctttgccatcaacgagctgcctgacctggccggtaaaatccaggtcgggctg
ttcaacatcatgcaggaaggggacgtgcagattaagggctttcccgtccggctcaagctg
gatgttgccctggtgttttcggccaaccctgaagactacacggcgcgcggcaaaatcatc
acgccgctcaaagaccggattggttcggaaatcctgacccactacccacagaccgttgag
gaaggcgtgcggatcacggcgcaggaagcttggactgaccgcccgtcccgcgcgccgatc
cacatcccgaagttcattcgggaaatcgtggaaaccattgcgtttgttgcccgtgaagac
cagcggattgaccgccggtcgggcgtcagccagcgattgcccatctcgttgctcgaaaat
gtcgtcagcagcgccgagcgccgggcgttgcgccaccacgaaaccatcatcgtgccgcgc
atttcggacatctacgcttcactgccggcgatcaccggcaaaatcgaactggagtacgaa
ggcgaacaggtcggcgcggaacgcattgcccgcgaactcatccgaactgcctgcggacgg
gtttatgataactacctggcgctggccgaaaccgggcgcatcgtcgagtggttcaatcag
ggccatagcctgaaggtgtctgaggcagattcttcagcggcgatactggaaaagatgcgc
gctattcggacacttatcgaagttgccgaaatgggcggctacgccgaaggccgcacgccg
gcgcacctggtttcggctgccgagctgattctggaagggctgcacgcccagcgcaaagtc
agccgttcggaagagcgtggctacggcaaggccgctccggctgaccggcggcgcggtcgg
cgtggcgacgacgaggatgacttcagcaactggggtggttttggaagcctcaactag

DBGET integrated database retrieval system