KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0669Help
Entry
Cabther_A0669     CDS       T01629                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cabther_A0669
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cabther_A0669
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cabther_A0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(785448..786386)
Genome map
AA seq 312 aa AA seqDB search
MEKPLSPAPRKVTIVGVPMDLGADRRGVDMGPSVVRIAGLSAKLAELGYDVEDVGNIPVA
LAEMRRATPADAKHKYLAEVAKSNALLADCVEGILERGAVPIVLGGDHSIAIGSVAGVAG
YYRRRGQRIGIIWIDAHADINTPESSPSGNIHGMPLAVLLGYGPEVLTHIGGFAPKIHPE
DCVIIGVRQIDEGERQLARQLGLRIYTMRDLDERGMSAIMDEAIAWVTRHTVGFHATFDM
DFVDPYYAPGVGTPVPGGGTYRESHLAMEKIHDSGKMLSVEMVEINAVLDAHNRTGELGA
ELLLSALGKKIL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacccctttctcctgctccccgcaaagtgaccattgtcggcgtgcccatggac
ttgggcgccgaccggcgcggcgtggatatggggccgtccgtcgtacgcattgccggcctc
agcgccaaactcgccgaactgggctacgacgtggaagacgttggcaacatcccggtcgca
ctggccgaaatgcgccgtgccacacctgccgacgccaaacacaagtatcttgctgaagtg
gccaaatcgaatgcccttctggccgattgtgtcgaagggattctggaacgcggcgcggtg
cccattgtccttggcggcgaccattcgattgccattggaagtgtggccggggtggccggt
tactaccgccgccggggccaacgcatcggcatcatctggattgacgcccatgctgacatc
aacacgccggagtcatccccttccggcaacatccacggcatgccgctggccgttctgctg
ggctacggccccgaagttttgacgcacattggcggttttgctccgaaaatacaccctgaa
gactgcgtcattatcggtgtgcgtcagattgatgaaggtgagcgtcaactcgcgcgtcaa
ttgggcctgcgcatctacacaatgcgcgatctcgatgaacgtggcatgagcgccatcatg
gatgaagccatcgcctgggttacacgccacacggttggttttcacgcgacattcgacatg
gacttcgttgacccttattatgcgcctggcgtcggcacgcccgttcccggcgggggcacc
tatcgtgaaagtcacctggcaatggagaaaattcacgattcaggcaaaatgctctcggtc
gaaatggtcgaaatcaatgccgttctcgatgcgcataatcggaccggcgaactgggcgcg
gaactcctgctctctgcgctcggcaaaaaaatcctgtaa

DBGET integrated database retrieval system