KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0753Help
Entry
Cabther_A0753     CDS       T01629                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-like enzyme (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A0753
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cabther_A0753
  Amino acid metabolism
   00310 Lysine degradation
    Cabther_A0753
Enzymes [BR:ctm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cabther_A0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:879848..881245
Genome map
AA seq 465 aa AA seqDB search
MRYEVVMPQMGESITEGTIIKWLKQIGDRVERDEPIFEISTDKVDAEIPAPQAGFLVEIL
VGENQTVPVNTVVAYISDEVPASAPDTQPAPAEAPAAVSAAVSAATPSATAAPSNGVTAA
TRIDEADVEDASETTDAFGVRSSPLVRRMAREHGIDLRQIRGTGIGGRITKHDVLAFLER
RQAAASTVVAPPATPAVTPPAPPAPATPSVMPPATPAMTAPAVAAPPPAALPGDEVEVVP
MTAMRKKIAERMVLSKHTSPHVTSVFEVDMTHIHRLRERNKREFEAQHGAKLTFLPFIVK
SVVDTLRAWPALNASIEGDNIIYKKHYHIGIAVALDWGLIVPVIRHAEEKNLIGLARSIS
DLANRARAKQLKPDEVVGGTFTITNYGSFGSLIGTPIINQPQVAILGVGAVVKRPVVTED
DAIAIRHMSYLSLTFDHRLIDGAVADQFMSQLKRTLETFQATELS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgaagttgtcatgcctcagatgggcgagtccatcacggaaggcaccatcatc
aagtggttgaaacagattggcgaccgcgtcgagcgggatgagccaatcttcgagatttca
accgacaaggtggatgcagaaataccggccccgcaggccggttttttggtggaaatcctc
gtcggtgagaaccagaccgtgccggtcaatacggtggtggcctacatcagcgatgaagtc
ccggcttccgcgccggatacccaaccggcaccggccgaagctccggcggcggtcagcgcc
gccgtttccgcggccacgccttcggcaaccgcagccccctccaacggtgtgacggccgcc
acccggattgatgaagccgatgtcgaggacgcttcggaaaccaccgacgcttttggcgtg
cggtcttcaccgctcgtgcgccggatggcgcgcgaacatggcattgatttgcgccagatt
cgcggcacgggcatcggcggacgcatcaccaagcacgatgttctggcctttctggagcgg
cgccaggccgcggcttcgacggtagttgcgccacccgccacaccggccgtgacgccgccc
gcgccaccggctccggcaacgccgtccgtgatgccgccggccacaccggcaatgactgcg
ccggctgttgccgcgccgcccccggccgccctgccgggcgatgaggttgaagtcgtcccg
atgacggcgatgcgcaaaaaaattgccgagcgcatggtgctcagcaagcatacgtcgccg
catgtcacttccgtctttgaagtggacatgacgcacattcaccggctgcgggagcggaac
aaacgtgagtttgaagcgcagcatggcgccaagctgacgtttttgcccttcatcgtcaaa
agcgtcgtggatacgctccgcgcctggccggcgctcaatgcctctatcgaaggtgacaac
atcatctacaaaaagcactaccacatcgggattgccgttgcgcttgactggggcctgatt
gtgccagtcattcgccatgccgaggagaaaaacctcatcgggctggcgcgcagtatcagc
gatctggcgaaccgggcgcgcgccaaacagctcaagcccgatgaagtcgtgggcggaacc
ttcaccatcacgaactacgggagtttcggcagcctcatcggaacgcccatcatcaaccag
ccgcaggtggccattctgggcgtgggcgcggtggtcaaacggccggtcgtcacggaagac
gatgccattgccatccgccacatgtcctacctgtcgctgacgtttgaccatcgcctgatt
gacggcgcggtggcggaccagttcatgtcccagctcaagcgaacgttggagacgttccag
gcgacggaactgagttag

DBGET integrated database retrieval system