KEGG   Chloracidobacterium thermophilum: Cabther_A0753Help
Entry
Cabther_A0753     CDS       T01629                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-like enzyme (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A0753
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cabther_A0753
  Amino acid metabolism
   00310 Lysine degradation
    Cabther_A0753
Enzymes [BR:ctm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cabther_A0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:879848..881245
Genome map
AA seq 465 aa AA seqDB search
MRYEVVMPQMGESITEGTIIKWLKQIGDRVERDEPIFEISTDKVDAEIPAPQAGFLVEIL
VGENQTVPVNTVVAYISDEVPASAPDTQPAPAEAPAAVSAAVSAATPSATAAPSNGVTAA
TRIDEADVEDASETTDAFGVRSSPLVRRMAREHGIDLRQIRGTGIGGRITKHDVLAFLER
RQAAASTVVAPPATPAVTPPAPPAPATPSVMPPATPAMTAPAVAAPPPAALPGDEVEVVP
MTAMRKKIAERMVLSKHTSPHVTSVFEVDMTHIHRLRERNKREFEAQHGAKLTFLPFIVK
SVVDTLRAWPALNASIEGDNIIYKKHYHIGIAVALDWGLIVPVIRHAEEKNLIGLARSIS
DLANRARAKQLKPDEVVGGTFTITNYGSFGSLIGTPIINQPQVAILGVGAVVKRPVVTED
DAIAIRHMSYLSLTFDHRLIDGAVADQFMSQLKRTLETFQATELS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgaagttgtcatgcctcagatgggcgagtccatcacggaaggcaccatcatc
aagtggttgaaacagattggcgaccgcgtcgagcgggatgagccaatcttcgagatttca
accgacaaggtggatgcagaaataccggccccgcaggccggttttttggtggaaatcctc
gtcggtgagaaccagaccgtgccggtcaatacggtggtggcctacatcagcgatgaagtc
ccggcttccgcgccggatacccaaccggcaccggccgaagctccggcggcggtcagcgcc
gccgtttccgcggccacgccttcggcaaccgcagccccctccaacggtgtgacggccgcc
acccggattgatgaagccgatgtcgaggacgcttcggaaaccaccgacgcttttggcgtg
cggtcttcaccgctcgtgcgccggatggcgcgcgaacatggcattgatttgcgccagatt
cgcggcacgggcatcggcggacgcatcaccaagcacgatgttctggcctttctggagcgg
cgccaggccgcggcttcgacggtagttgcgccacccgccacaccggccgtgacgccgccc
gcgccaccggctccggcaacgccgtccgtgatgccgccggccacaccggcaatgactgcg
ccggctgttgccgcgccgcccccggccgccctgccgggcgatgaggttgaagtcgtcccg
atgacggcgatgcgcaaaaaaattgccgagcgcatggtgctcagcaagcatacgtcgccg
catgtcacttccgtctttgaagtggacatgacgcacattcaccggctgcgggagcggaac
aaacgtgagtttgaagcgcagcatggcgccaagctgacgtttttgcccttcatcgtcaaa
agcgtcgtggatacgctccgcgcctggccggcgctcaatgcctctatcgaaggtgacaac
atcatctacaaaaagcactaccacatcgggattgccgttgcgcttgactggggcctgatt
gtgccagtcattcgccatgccgaggagaaaaacctcatcgggctggcgcgcagtatcagc
gatctggcgaaccgggcgcgcgccaaacagctcaagcccgatgaagtcgtgggcggaacc
ttcaccatcacgaactacgggagtttcggcagcctcatcggaacgcccatcatcaaccag
ccgcaggtggccattctgggcgtgggcgcggtggtcaaacggccggtcgtcacggaagac
gatgccattgccatccgccacatgtcctacctgtcgctgacgtttgaccatcgcctgatt
gacggcgcggtggcggaccagttcatgtcccagctcaagcgaacgttggagacgttccag
gcgacggaactgagttag

DBGET integrated database retrieval system