KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0776Help
Entry
Cabther_A0776     CDS       T01629                                 

Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cabther_A0776
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cabther_A0776
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cabther_A0776
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cabther_A0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(903111..904499)
Genome map
AA seq 462 aa AA seqDB search
MKRRSFLSHLAFSPVAWSLLRLQTEGAETDALLSGPLVGYSEMTETMIWLQTRRPARVQV
RYWVQGKPETTRLSEEYRTTHAGDGIAKFTLSGLTFGTRYDYEVYVDGARIERPYPMTFQ
TQPMWKWRTEPPPFKVAFGSCHYVNDPPFDRPGRPYGDSPKVFSAILAQKPDLMLWLGDN
CYYREADYQTEAGMRYRYAHTRAQAELQPLWAAVHHYAIWDDHDYGPNDSDRTFRRRDTA
LRIFRDYWCNPTHGTPETPGCFFRFDWADVEFFMLDGRYHRMPNHLPDDAPDKTMLGPEQ
LGWLLESLRSSEATFKVVASGGQVLNPVSPWECFGRFKVEQSRIFDFIRSEKIPGVVFIS
GDRHLAELNRRLEPNLYPLYDFTSSSLTAGVAKLSKAEQDNPCRVPGTLVEKHNFGILEF
SGPRANRLLTMRCFDENGDEQWKREIPISELRFPRPSEESER
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgacgttcctttctcagccacctggccttttccccggtggcctggtccctcctg
cggctacagacggaaggggcagagacggatgccctgctttccggtccgctggttggttac
agcgaaatgaccgaaacgatgatctggctgcaaacccggcggccggcccgcgtccaggta
cgctattgggtgcagggcaagccggagacgacccggctcagtgaggaataccgcacaacc
cacgccggagacggcatcgccaaattcaccctttccgggctgacctttggcacacgctat
gactacgaagtttatgtggatggagcgcgcattgagcggccctatccgatgacctttcaa
acccagccgatgtggaaatggcggacggagccaccgcccttcaaagtggcttttggttcg
tgccactacgtcaatgacccgccctttgaccgtccggggcgaccctatggcgattcgccc
aaggtattttccgccatcctggctcagaagccggacctgatgctgtggctcggcgacaac
tgctactaccgcgaagcggactaccagacagaagccgggatgcggtatcgctatgcccac
acccgcgcccaggcggaactccaaccgctgtgggcggctgttcaccactacgccatctgg
gatgaccacgactacgggccgaatgattcggatcgcacgttccgccgtcgggatacggcc
ctgcgcattttccgggactactggtgtaacccgacccacggcacaccagaaacgccgggc
tgctttttccggtttgactgggctgatgttgagttcttcatgctcgacgggcgttaccac
cggatgcccaatcacctgcccgacgacgcaccagacaaaaccatgttggggccggagcaa
ctcggctggctgctggagtcattgcgttccagcgaggccacgttcaaggtggtcgccagc
ggcggacaggtgctcaaccctgtttctccctgggagtgcttcggccggttcaaggttgaa
cagtcccggatattcgatttcatccgttcggagaaaatccccggtgtcgtcttcatttcg
ggagatcgccacctggccgaactcaaccggcgcctggaaccgaatctctatccgctctac
gacttcacatcgagttccctgaccgccggtgtggccaagctctccaaagccgagcaggac
aacccctgccgggtgccggggacactcgttgagaagcacaacttcggcattctggagttt
tccggcccacgcgccaaccggctgctcaccatgcgctgctttgacgagaacggcgatgag
cagtggaagcgggaaattcccatcagcgagttgcgctttccacgtccatcggaagaatca
gaacggtag

DBGET integrated database retrieval system