KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0873Help
Entry
Cabther_A0873     CDS       T01629                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ctm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ctm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1036748..1037704
Genome map
AA seq 318 aa AA seqDB search
MNTKAVSGLVSHIVADRIRKLAATDSLRTITMRKIRKAIFPAAGLGTRFLPATKAQPKEM
LPLVDKPLIQYGIEEAILSGIEQVIIVTGRGKNAIEDHFDISFELEHLLREKGKLDLLEQ
VQEISKINVSYVRQKQALGLGHAVLVARELVGDEPFAVILGDDIVDSKVPCLRQMIEVYE
RYGRSVIGTARVEGEAISRFGVLAVDPIEDRVYKIRDMVEKPPFAEAPSNLAIIGRYILM
PEIFDVLEKTPKGAGGEIQLTDAMRLLLKEQAMYAHEFHGVRHDAGDKLGFLIATVEFAL
QRPDLGPEFRAYLKSLTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccaaagctgtttcagggcttgtgtcccacatcgttgccgaccggattcggaaa
ctggcggccactgactcgctgagaaccatcaccatgaggaaaatccgtaaagccatcttt
cctgccgccgggttggggacccgttttttgccggcgacgaaagcccaacccaaggaaatg
ctgccgctcgtggacaaaccgctcatccagtacggcatcgaggaagccattctgagcggc
atcgagcaggtcatcatcgtcaccgggcgcgggaagaacgccattgaggaccactttgac
atttccttcgagctggaacatctgctgcgcgagaaaggcaaactcgatctgctcgaacag
gttcaggaaatttccaagatcaacgtctcgtacgtgcggcaaaaacaggccctgggattg
ggccacgccgtgctcgtcgcccgcgaactggtgggcgacgaacccttcgccgtgattctt
ggggacgacatcgtggactccaaagtgccctgcctgcgccagatgatcgaggtgtatgaa
cgttacgggcgctccgtcatcggaaccgcccgcgtggaaggcgaggccatttcccgcttc
ggcgtgctggccgtggaccctatcgaagaccgggtctataaaatccgcgacatggttgaa
aagccaccctttgccgaagcgccatccaacctggccatcatcggtcgttacattctcatg
ccggaaatcttcgacgtgctggaaaagacacccaaaggtgccggcggagagattcagctc
accgacgccatgcgcctgttgctcaaagagcaggccatgtatgcgcacgagttccacggc
gtccgccacgatgccggcgacaagctcggttttctcatcgccacggtcgagtttgcgctt
cagcgtccagacctcggcccggagttccgcgcctatctcaagtcactcaccctgtaa

DBGET integrated database retrieval system