KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0873Help
Entry
Cabther_A0873     CDS       T01629                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cabther_A0873
   00052 Galactose metabolism
    Cabther_A0873
   00500 Starch and sucrose metabolism
    Cabther_A0873
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A0873
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cabther_A0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1036748..1037704
Genome map
AA seq 318 aa AA seqDB search
MNTKAVSGLVSHIVADRIRKLAATDSLRTITMRKIRKAIFPAAGLGTRFLPATKAQPKEM
LPLVDKPLIQYGIEEAILSGIEQVIIVTGRGKNAIEDHFDISFELEHLLREKGKLDLLEQ
VQEISKINVSYVRQKQALGLGHAVLVARELVGDEPFAVILGDDIVDSKVPCLRQMIEVYE
RYGRSVIGTARVEGEAISRFGVLAVDPIEDRVYKIRDMVEKPPFAEAPSNLAIIGRYILM
PEIFDVLEKTPKGAGGEIQLTDAMRLLLKEQAMYAHEFHGVRHDAGDKLGFLIATVEFAL
QRPDLGPEFRAYLKSLTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccaaagctgtttcagggcttgtgtcccacatcgttgccgaccggattcggaaa
ctggcggccactgactcgctgagaaccatcaccatgaggaaaatccgtaaagccatcttt
cctgccgccgggttggggacccgttttttgccggcgacgaaagcccaacccaaggaaatg
ctgccgctcgtggacaaaccgctcatccagtacggcatcgaggaagccattctgagcggc
atcgagcaggtcatcatcgtcaccgggcgcgggaagaacgccattgaggaccactttgac
atttccttcgagctggaacatctgctgcgcgagaaaggcaaactcgatctgctcgaacag
gttcaggaaatttccaagatcaacgtctcgtacgtgcggcaaaaacaggccctgggattg
ggccacgccgtgctcgtcgcccgcgaactggtgggcgacgaacccttcgccgtgattctt
ggggacgacatcgtggactccaaagtgccctgcctgcgccagatgatcgaggtgtatgaa
cgttacgggcgctccgtcatcggaaccgcccgcgtggaaggcgaggccatttcccgcttc
ggcgtgctggccgtggaccctatcgaagaccgggtctataaaatccgcgacatggttgaa
aagccaccctttgccgaagcgccatccaacctggccatcatcggtcgttacattctcatg
ccggaaatcttcgacgtgctggaaaagacacccaaaggtgccggcggagagattcagctc
accgacgccatgcgcctgttgctcaaagagcaggccatgtatgcgcacgagttccacggc
gtccgccacgatgccggcgacaagctcggttttctcatcgccacggtcgagtttgcgctt
cagcgtccagacctcggcccggagttccgcgcctatctcaagtcactcaccctgtaa

DBGET integrated database retrieval system