KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0901Help
Entry
Cabther_A0901     CDS       T01629                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cabther_A0901
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cabther_A0901
Enzymes [BR:ctm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cabther_A0901
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Cabther_A0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1070556..1071347
Genome map
AA seq 263 aa AA seqDB search
MTDRMMSCAPARPTLADIVSARRRSVAAHRPVSLSELAPAQGTFLPALCRNAPAIIAEIK
PVSPAEGVLQSTPDLARVLAAYDAHAVALSVLTEPDYFGGSFDLLAAVAHRSSRPTLCKD
FVLDVRQIHAARAAGAEAVLLIVKILDDEQLCRLSAEIQRWNMTPVVEVQTEAELERALA
LDPSVILINNRNLETFDISLETTQRLAPRVPSQVVTIAASGIRCRADIEALLPYCPRFLI
GTHLMRAPDLEAAFVNLLGKAYA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccggatgatgagctgcgcacctgcccgtccaacccttgccgacatcgtatcc
gcccgccgccggtctgtggccgctcaccgcccggtttcgctgtctgaactggcaccggca
caggggacgttcctcccggctttgtgccgcaatgcacctgccatcattgccgaaatcaag
cctgtgtcaccggccgaaggtgtcctgcagtccacgcccgatctggcgcgtgtgctggcc
gcttatgacgcccacgccgtcgcgctttcggttctgactgagccggactacttcggagga
agttttgacctgctggcggccgtggcgcaccgttccagccgcccaaccctgtgcaaggac
ttcgtgctcgatgtgcgtcagatacacgccgcacgtgccgctggcgcggaagctgtactg
ctcatcgtcaaaattctcgacgacgagcagctctgccggctctccgctgaaatccaacgc
tggaatatgacgccggttgtggaagtgcagaccgaagccgaactggaacgcgccctggcg
ctggacccgtccgttatcctcatcaacaaccgcaacctggagacctttgacatctctttg
gagaccacgcaacgtcttgcgccgcgcgtaccttcccaggttgtgaccattgcagccagc
ggtatccggtgccgcgccgacatcgaggcgctgcttccgtactgcccgcgctttctcatc
gggacgcacctgatgcgcgcgccggacctggaagctgcttttgtcaaccttcttggaaaa
gcgtatgcctaa

DBGET integrated database retrieval system