KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1023Help
Entry
Cabther_A1023     CDS       T01629                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ctm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1207298..1209127)
Genome map
AA seq 609 aa AA seqDB search
MSSFFVIFHPDGRPVAPPMVARLLQRLAWRGPDGQSHWYEAHVALGYAHLHVDDLTRTPP
PLTFDGQVWLAADIRLDAREGLCRAIQTAGGEADQDMPDARLLWQAYHLWELDCLHYLQG
DFAFALWDARRRRLFCARDPFAVKPLYYSYQPGLFVASSDLATICAHPQIPTSIPTDLDD
FAVADFLIEGMKLDEDGTFYRAIRRLPRATALCLEGGARRQWRYWDWPTDGCLRYARTRD
YVEHFQALLEQAVADRLRAPRASVLLSGGLDSNVVTAAARRACLTTDLRAFTCVFNTLIP
DRERHFAGLAAQGHGIPITFVEQDNWQPYAPPPAGVPPPPEPVHEPFWNGIMESYRQVGS
HARIVLTGQWGDEVMLQETAPYLRDLVARRQLLRLGEALVAYFVADVRNGFFSLRRQFGR
ILGRKHPTRSEIPRWLATDFVTRLRRAGYFERMQPSPPPHPYRRHMLRVLNRVHLANDHE
YSDMAFTGTLVEIRSPLLDQRILEFFLAAPTVPLCLDKWLFRELLKNRLPRAVVRRAKAP
LPQFPVTGYIRRHGTSWAQLPSEARHYLSCFVNVEALPTPLVWDARHEAKSFVDLSPLSL
YKWLQSKIV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcttttttgtcatcttccaccctgacgggcggccagttgcgccaccgatggtc
gcgcgtttgctccagcggttggcctggcgtgggcctgacggtcaatcccactggtacgag
gcacacgtggcgctgggctatgcccatctccacgtggatgacctgacgcgcaccccaccg
ccactgacctttgatgggcaggtgtggctggccgccgacatccggctggatgcgcgcgaa
ggactctgccgtgccatccagacggctggcggggaggccgaccaagatatgccggatgcc
agactgctctggcaggcgtaccacctgtgggagttggattgcctgcactaccttcagggc
gactttgcctttgccctgtgggatgcccgtcgccgacggctgttctgcgcgcgcgacccg
ttcgccgtcaagccgctctattacagctatcagccggggctgtttgttgcctccagcgac
cttgcgaccatctgcgcccacccgcagattcccacctccatcccaaccgatttggacgac
tttgccgttgccgattttctcatcgaagggatgaagctggacgaagacggcacgttttac
cgcgccatccgccgcctgccacgggctacggcgctgtgccttgaagggggtgcacggcgg
cagtggcgttactgggattggccaaccgatgggtgtctccgctatgcccgcacaagggat
tacgtcgagcattttcaggcacttctggaacaggctgtagctgaccggctgcgcgcacca
cgtgcatctgttcttctcagcggcgggctggattccaacgtggtgacggccgccgcgcga
cgcgcctgcctaacgactgacctccgcgcttttacctgtgttttcaacacactcattccc
gaccgcgaacggcatttcgccgggctggccgcccaaggtcacggtattcccatcaccttc
gttgagcaggacaactggcagccgtatgcgccccccccggccggcgttcccccaccacct
gagccggttcacgaacccttctggaatggcatcatggaaagttaccgccaggtgggcagc
cacgcccgcattgtcctgaccgggcagtggggcgatgaagtcatgcttcaggaaacagca
ccctacctgcgcgatctcgttgcccggcggcagttactccgcttgggcgaggctcttgtg
gcgtactttgtagctgacgtccgcaatggcttcttttcacttcggcgtcagtttgggcgg
atacttggacgaaaacacccaacccggtcagaaatcccccgctggctggcaacagacttt
gtgacgcgcctgcgtcgggctggctatttcgagcgcatgcaacccagtccaccaccgcac
ccctaccggcggcatatgctacgggtgctaaatcgggttcacctggctaatgaccatgaa
tacagcgatatggctttcaccggcactttggtggaaatccgctccccgttgcttgaccag
cgcatcctcgagtttttcctggcagcgccgactgtgcccctttgcctcgacaagtggctt
ttccgggaactgctcaaaaaccggcttccacgcgctgttgtccggcgtgccaaggctccc
cttcctcagtttcccgtcaccggctacatcaggcggcacggcacaagttgggcgcaactt
ccatcggaagctcgccactacctgtcttgttttgtgaacgtcgaagccttgccaactcct
cttgtgtgggatgcacggcacgaagccaaatcttttgttgacctcagcccgttgagtctg
tataaatggctgcaatccaagattgtgtaa

DBGET integrated database retrieval system