KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1046Help
Entry
Cabther_A1046     CDS       T01629                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cabther_A1046
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cabther_A1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1237361..1237960
Genome map
AA seq 199 aa AA seqDB search
MITHLTGTLLEKSSASVVVGVGGIGFSVGVSLYTYDRLPEVGNTVSLHTYLLVREDALLL
YGFCDRIEREFFLRLLAIAGVGARTALAVLSGFSPADLAQVILAGDGRRLSGVPGIGKKM
AERIIIELRDKLPDVPLPHVAVQSPANADEPLRRDVVSALINFGWSPAVVEKAVAQTLAE
ETSRDLSYLIKQTMKRLYR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattacgcatctgacagggacattgctggagaaaagctcggcatcggttgtggtcgga
gttggcggcatcggtttcagcgtaggggtttcgctctacacctatgaccgtctgccggag
gtcgggaacaccgtgtccctgcacacttacctgctcgtccgcgaggacgccttgttgctg
tatggtttttgtgaccggatcgaacgggagttcttcctgcgcctgctggccattgccggc
gtgggtgcgcggacggcgctggcggtgctgtccggcttcagcccggcggacctggcgcag
gtcattcttgccggtgatggccgacggctgtccggtgtgccgggtatcggaaagaagatg
gctgagcgtattatcattgagttgcgcgacaagctcccggatgtcccgctcccccacgtg
gctgtccagtccccggccaatgctgacgaacctctcaggcgggatgttgtttcggcgctc
atcaacttcggctggtcgccggcagtcgtggaaaaggccgtggcgcagacgctggccgag
gaaacgagccgggatttgagctacctcatcaagcagaccatgaagcgactctaccgctag

DBGET integrated database retrieval system