KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1190Help
Entry
Cabther_A1190     CDS       T01629                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cabther_A1190
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cabther_A1190
Transfer RNA biogenesis [BR:ctm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cabther_A1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1403721..1404536)
Genome map
AA seq 271 aa AA seqDB search
MLDSETSFACQLVTEAGQRILSDFQPGRPVSYKPDGEPVTDMDRAINTFLVTELQRRFPD
DLIISEEAEDDDARRRALAHRVWFIDPIDGTREFIAGNGEFSVMIGLCVEGCPVMGVVHQ
PTTGKTWYANRHGAWLTQGNTCRPLRVSSVNHIPDMTLAASRSHRNRYLTAAAQRLGIQK
EIISGSGGLKIGLLVEQRADLFISASTRSKLWDTAGPEAILRAAGGVLTDFQGRPLDYRQ
PDLHHRAGLIASNGLQHAAIVAQVRDLFPLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattccgaaaccagctttgcctgccagttggtcacagaagccgggcagcgcatc
ctctccgacttccaacccggccgcccggtcagctacaaacctgatggagaaccggtaacg
gacatggatcgcgccatcaacacatttctggtaacagaactccagcgccgcttcccggac
gacctcatcatttctgaagaagcggaggacgacgatgcccggcggcgtgctttggcgcac
cgggtctggtttatcgatccgattgacggcacacgggaattcatcgccggcaatggcgaa
ttctctgtcatgatcggtctgtgtgtggaaggctgtcccgtcatgggagttgtccaccag
cccacaaccggcaaaacctggtatgccaaccgccacggcgcctggctcacccagggaaac
acctgtcggccgttgcgggtttcgtccgtcaaccatatccccgacatgaccttggcggcc
agccggtcgcaccgcaaccgctacctcacggcggccgcgcagcggctaggcatccagaaa
gaaatcatctccggcagcggcggactcaaaatcgggctgctcgtcgaacaacgcgccgac
ctgtttatcagcgcctcgacccgctccaagctctgggatactgccgggccggaagccatc
ctgcgggcagccggcggtgtactgacggattttcagggccggccactcgactaccgccag
ccggacctgcatcatcgggccggattgattgccagcaacggtctccagcacgcggccatc
gttgcccaagtccgtgatttgtttcctctggcgtag

DBGET integrated database retrieval system