KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1190Help
Entry
Cabther_A1190     CDS       T01629                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ctm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1403721..1404536)
Genome map
AA seq 271 aa AA seqDB search
MLDSETSFACQLVTEAGQRILSDFQPGRPVSYKPDGEPVTDMDRAINTFLVTELQRRFPD
DLIISEEAEDDDARRRALAHRVWFIDPIDGTREFIAGNGEFSVMIGLCVEGCPVMGVVHQ
PTTGKTWYANRHGAWLTQGNTCRPLRVSSVNHIPDMTLAASRSHRNRYLTAAAQRLGIQK
EIISGSGGLKIGLLVEQRADLFISASTRSKLWDTAGPEAILRAAGGVLTDFQGRPLDYRQ
PDLHHRAGLIASNGLQHAAIVAQVRDLFPLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattccgaaaccagctttgcctgccagttggtcacagaagccgggcagcgcatc
ctctccgacttccaacccggccgcccggtcagctacaaacctgatggagaaccggtaacg
gacatggatcgcgccatcaacacatttctggtaacagaactccagcgccgcttcccggac
gacctcatcatttctgaagaagcggaggacgacgatgcccggcggcgtgctttggcgcac
cgggtctggtttatcgatccgattgacggcacacgggaattcatcgccggcaatggcgaa
ttctctgtcatgatcggtctgtgtgtggaaggctgtcccgtcatgggagttgtccaccag
cccacaaccggcaaaacctggtatgccaaccgccacggcgcctggctcacccagggaaac
acctgtcggccgttgcgggtttcgtccgtcaaccatatccccgacatgaccttggcggcc
agccggtcgcaccgcaaccgctacctcacggcggccgcgcagcggctaggcatccagaaa
gaaatcatctccggcagcggcggactcaaaatcgggctgctcgtcgaacaacgcgccgac
ctgtttatcagcgcctcgacccgctccaagctctgggatactgccgggccggaagccatc
ctgcgggcagccggcggtgtactgacggattttcagggccggccactcgactaccgccag
ccggacctgcatcatcgggccggattgattgccagcaacggtctccagcacgcggccatc
gttgcccaagtccgtgatttgtttcctctggcgtag

DBGET integrated database retrieval system