KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1232Help
Entry
Cabther_A1232     CDS       T01629                                 

Definition
glucokinase, proteobacterial type (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A1232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_A1232
   00052 Galactose metabolism
    Cabther_A1232
   00500 Starch and sucrose metabolism
    Cabther_A1232
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A1232
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cabther_A1232
   00524 Butirosin and neomycin biosynthesis
    Cabther_A1232
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cabther_A1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1461669..1462658)
Genome map
AA seq 329 aa AA seqDB search
MTMTRYLLAGDVGGTKTHLGLFDAATLALLETRTFASADFSDLPAMLRSFFGGRALRCQA
ACIGAAGPVLDGVCQITNLSWSIRADELRQVLDCPAFVINDLEANGNGIALLAPSDFYQL
QAGTPRLGNAALISAGTGLGECILFWDGTRHIAVPSEGGHASFSPSDPTELDLLAYLWQT
YDHVSWERLVSGTFGFAHLYHFFRDTGRAAGSAALEALAATHGYGAAISKFADEGLPIAV
AVMERFVALYGAEAGNLALKALATEGLFIGGGIAPKILKWMTKGDFLGAFVAKGRFRSFL
EQVPVAVILNEQTALLGAARYARHHAHLS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccgttacctcctggccggagatgtgggtggcacgaaaacccacctcgga
ctgtttgacgccgccacccttgccctgctcgaaacccgaaccttcgccagcgctgatttc
agcgatctgccagccatgctgcggtcattttttggtgggcgggcgctccgctgccaggct
gcctgcattggcgcagccggacctgtcctcgatggcgtgtgccagattaccaacctgtcc
tggagcatccgtgcggatgaactgcggcaggtactcgactgcccggcctttgtcatcaat
gacctcgaagccaacggcaacgggattgccctgctggcaccgtcggacttttaccaactt
caggccggtacaccccgcctgggcaacgcggccctgatctcggccgggacaggtctcggc
gagtgcattctgttctgggatggaacacgccacattgccgttccgtcggaaggtggccac
gccagcttttctcccagcgatccgacggagctggacctgctggcgtatctctggcagacc
tatgatcacgtaagctgggagcggctggtgtccgggacgtttggctttgcccacctgtac
cattttttccgtgacaccgggcgtgccgccggttccgctgcgctggaagctttggctgct
actcatggctacggtgcagccatctcgaagtttgccgacgaaggattgccgattgccgtg
gcggtgatggagcggttcgtggccctctatggtgctgaagctggcaacctggccctgaag
gccctagccaccgaggggctgtttatcggcggcggcattgcgcccaaaatcctcaagtgg
atgaccaagggcgattttctgggcgcattcgtcgccaagggacgttttcggagctttctg
gagcaggttccagtggccgtcatcctcaatgagcagacggcactgctgggcgcagcccgg
tatgccaggcatcacgcccacctttcctga

DBGET integrated database retrieval system