KEGG   Chloracidobacterium thermophilum: Cabther_A1233Help
Entry
Cabther_A1233     CDS       T01629                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00010  Glycolysis / Gluconeogenesis
ctm00520  Amino sugar and nucleotide sugar metabolism
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01120  Microbial metabolism in diverse environments
ctm01130  Biosynthesis of antibiotics
ctm01200  Carbon metabolism
Module
ctm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_A1233
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A1233
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cabther_A1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK B277
Motif
Other DBs
NCBI-ProteinID: AEP11987
UniProt: G2LDC7
Position
1:complement(1462674..1463435)
Genome map
AA seq 253 aa AA seqDB search
MGIDIGGTGVKGAPVDLRTGTLTQERFRLLTPQPATPDAIAETVFEVIRHFGWSERDGAI
GIGLPSVVKHGVAHTAGNIDPAWIGCDAATLFKNTTGYTVTLLNDADAAGLAEMRFGAGR
DLAGLVAIVTLGTGIGTALFHNGQLIPNTELGHLIIRDKDAERRASLSARERQNWSWKKW
AGYVSEYLTELHRLLWCDAFILGGGASNKFDKFAAYLTCPTPVLPARMANLAGIIGAALA
TVPATQARAKSPS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgggcattgacattggcggtaccggcgtcaaaggggcgccggttgacctccgcactggc
acgcttacccaggaacggttccgtctgctcacgccacagccggcgacaccggacgccatt
gccgaaaccgtttttgaggtcatccgccactttggatggagtgagcgtgacggcgccatt
ggcatcgggctgccttccgtcgtcaagcacggtgtggcgcacacggccggcaacattgac
ccggcctggattggctgtgacgccgccaccctgttcaaaaacaccaccggctacacggtg
acgttgctcaatgacgccgacgccgccgggctggccgagatgcgctttggcgccggccgc
gaccttgccgggctggtggccatcgtcaccctgggcaccggcatcggcaccgcacttttc
cataacgggcagcttattcccaacactgagctgggccacctgatcatccgtgataaggac
gccgagcggcgggcttccttgtcggcacgtgagcggcagaactggtcatggaaaaagtgg
gctgggtatgtcagcgaatacctcactgaattgcaccggctgctctggtgtgatgccttt
attctcggcggcggcgccagcaacaaattcgacaagtttgcggcgtacctgacctgtccg
accccggtgctcccggcccggatggctaacctcgccgggatcatcggggctgccctggcc
actgtcccggcaacacaggccagagccaaatcaccttcctga

DBGET integrated database retrieval system