KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1449Help
Entry
Cabther_A1449     CDS       T01629                                 

Definition
FAD dependent oxidoreductase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cabther_A1449
   00330 Arginine and proline metabolism
    Cabther_A1449
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Cabther_A1449
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Cabther_A1449
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Cabther_A1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1724212..1725165
Genome map
AA seq 317 aa AA seqDB search
MVTSRSALVIGCGISGLACARRLQAAGYHVTIITREQPKSTTSNVAAALWYPYRCAPREK
ALPWSKATFEELLRQHRDGVPGVTPTTFIELFDHDRPTPWWAEATGGVTRLTGNDLPPGY
AVGFAATVPVVETPLYLPYLVEQFSAAGGTLQLGELTSLDEACAAYPLVINCSGLGARTL
ANDPEVFPIRGQVVRVSNPGVRRALTDDDGPRRISYTIPRQTDVILGGTALPHVWDTTPD
AATTERILRHCRELEPALASAQVLEVRVGLRPGRTAVRLEREHRGVGVVIHNYGHGGAGF
TLAWGCADEVLHLARAT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggttacttcccgttcggcactggtcatcggctgtggcatctccgggctggcctgcgcc
cggcgactgcaagccgccggctaccacgtcaccatcatcacccgcgaacagccaaaatcc
acaacttccaacgtcgctgcggcgctctggtatccctaccgctgcgctccccgcgaaaaa
gccctgccatggtcgaaggccacctttgaagaactcctgcgccagcaccgggacggcgtt
ccgggcgtcaccccgacgacgttcatcgagcttttcgaccacgaccgccctacaccctgg
tgggctgaagccaccggcggcgtcacccgtctcaccggaaacgacctgccgcccggttat
gccgtcggctttgccgccaccgtaccggttgtggaaacaccactgtatctcccctacctc
gtggaacagttctcagcggcaggcggtacactccagctcggcgaactcaccagtctggat
gaggcctgcgctgcgtacccgctggtcatcaactgctccggtctgggggcacggacgctc
gccaatgaccccgaagtgttcccgatccgcgggcaggtggtacgggtttccaatcccggc
gtacggcgtgccctgaccgatgacgacggcccacgccgcatcagctacacgatcccacgc
cagacggatgtcattctgggcggcacggcgctgccccacgtctgggataccactcccgat
gcagcgacaaccgaaagaatcttgcgccactgccgcgagcttgagccggcgctggcctca
gcacaggtgcttgaagtgcgggtcgggctgcgtccggggcggacggccgtccgcctggaa
cgggaacaccgtggcgtgggcgtcgtcattcacaactacggccacggcggcgcgggcttc
accctcgcctggggctgtgcggacgaggtgcttcacctggcgcgtgcaacgtaa

DBGET integrated database retrieval system