KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1540Help
Entry
Cabther_A1540     CDS       T01629                                 

Definition
beta-glucosidase-related glycosidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ctm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1858518..1859624)
Genome map
AA seq 368 aa AA seqDB search
MFSLEQKVGQLLFIGLPGPTLDVEAQQLIKSIQPGGVILFARNLESPQQTAELTADIRRF
SRVMPLIAIDQEGGRVDRLRHLAGPMPSAKQISLADDAKLAFELGVVTADLLRLLGFNIN
FAPVLDIEFPHDQPNGLEERCWGGQAMTVIRFAGTYLEGLQNHGILGCGKHFPGLGDTAV
DSHHALPTVNRSEKQLLAEDLRVYADLFSTLYTRVPAVMTAHASYPAFDGHSGIPASLSR
NVVTDLLRKRMEFSGIAICDDLEMGAIQKTVEFPEAAVRAVEAGNDMLLICSRPDLMQEA
QTALVRAVETGRIPRSRLEVSIDRIAKVKAMVMAPYPYSAEAFRRVTERLAALHRAVMES
AAPQETLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgctggaacaaaaagtcgggcagttgttgttcatcggcttgcctggcccaacc
ctggatgttgaagcacagcagcttatcaagtccatccagccgggtggtgtcattctcttt
gcccgaaatctggagtccccgcagcaaacggccgaactgacggccgacatccgccgcttc
agtcgggtgatgccgcttattgcgattgaccaggaaggcggacgggtggaccgtctccgc
cacctggccgggccgatgccctccgcaaagcagatttcacttgcggatgacgccaaattg
gcctttgaactgggagtggtgacagcggatttgctccggctgttgggcttcaacatcaac
tttgccccggtactcgacatcgagttcccacacgaccaacccaacggactcgaagagcgt
tgctggggtgggcaggccatgacggtcatccgctttgccgggacctatctcgaaggtttg
cagaaccacggcattctgggatgtggcaaacactttccgggtctgggcgacacagccgtg
gattcccaccatgccctgcccaccgtcaaccgttcggaaaagcagcttctggcagaagac
ctgcgggtttacgccgacctgttcagcacgctctacacccgtgttccggcggtgatgacc
gctcatgccagttatccggcctttgacgggcacagtgggattccggcctcgctgtcccgt
aacgtcgtgacggacctgctccgcaagcgcatggagttttccggcattgccatctgtgat
gatctggaaatgggcgccatccagaaaaccgttgagtttccagaagctgccgtccgtgcc
gttgaagctggtaatgacatgttgcttatctgtagccgtcctgacctgatgcaggaagcc
cagacggcgctcgtgcgtgctgtggagaccgggcggattccccggtcgcggctggaggtc
tcaattgaccggattgccaaagtcaaagccatggtcatggctccctatccctacagcgcc
gaggcgttccgccgggtaacagagcggttggccgcccttcaccgggcagtgatggagtca
gccgcgccgcaggaaaccctgtcctga

DBGET integrated database retrieval system