KEGG   Chloracidobacterium thermophilum: Cabther_A1540Help
Entry
Cabther_A1540     CDS       T01629                                 

Definition
(RefSeq) beta-glucosidase-related glycosidase (EC:3.2.1.52)
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A1540
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Cabther_A1540
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cabther_A1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1858518..1859624)
Genome map
AA seq 368 aa AA seqDB search
MFSLEQKVGQLLFIGLPGPTLDVEAQQLIKSIQPGGVILFARNLESPQQTAELTADIRRF
SRVMPLIAIDQEGGRVDRLRHLAGPMPSAKQISLADDAKLAFELGVVTADLLRLLGFNIN
FAPVLDIEFPHDQPNGLEERCWGGQAMTVIRFAGTYLEGLQNHGILGCGKHFPGLGDTAV
DSHHALPTVNRSEKQLLAEDLRVYADLFSTLYTRVPAVMTAHASYPAFDGHSGIPASLSR
NVVTDLLRKRMEFSGIAICDDLEMGAIQKTVEFPEAAVRAVEAGNDMLLICSRPDLMQEA
QTALVRAVETGRIPRSRLEVSIDRIAKVKAMVMAPYPYSAEAFRRVTERLAALHRAVMES
AAPQETLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgctggaacaaaaagtcgggcagttgttgttcatcggcttgcctggcccaacc
ctggatgttgaagcacagcagcttatcaagtccatccagccgggtggtgtcattctcttt
gcccgaaatctggagtccccgcagcaaacggccgaactgacggccgacatccgccgcttc
agtcgggtgatgccgcttattgcgattgaccaggaaggcggacgggtggaccgtctccgc
cacctggccgggccgatgccctccgcaaagcagatttcacttgcggatgacgccaaattg
gcctttgaactgggagtggtgacagcggatttgctccggctgttgggcttcaacatcaac
tttgccccggtactcgacatcgagttcccacacgaccaacccaacggactcgaagagcgt
tgctggggtgggcaggccatgacggtcatccgctttgccgggacctatctcgaaggtttg
cagaaccacggcattctgggatgtggcaaacactttccgggtctgggcgacacagccgtg
gattcccaccatgccctgcccaccgtcaaccgttcggaaaagcagcttctggcagaagac
ctgcgggtttacgccgacctgttcagcacgctctacacccgtgttccggcggtgatgacc
gctcatgccagttatccggcctttgacgggcacagtgggattccggcctcgctgtcccgt
aacgtcgtgacggacctgctccgcaagcgcatggagttttccggcattgccatctgtgat
gatctggaaatgggcgccatccagaaaaccgttgagtttccagaagctgccgtccgtgcc
gttgaagctggtaatgacatgttgcttatctgtagccgtcctgacctgatgcaggaagcc
cagacggcgctcgtgcgtgctgtggagaccgggcggattccccggtcgcggctggaggtc
tcaattgaccggattgccaaagtcaaagccatggtcatggctccctatccctacagcgcc
gaggcgttccgccgggtaacagagcggttggccgcccttcaccgggcagtgatggagtca
gccgcgccgcaggaaaccctgtcctga

DBGET integrated database retrieval system