KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1548Help
Entry
Cabther_A1548     CDS       T01629                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cabther_A1548
DNA repair and recombination proteins [BR:ctm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cabther_A1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1868176..1868781)
Genome map
AA seq 201 aa AA seqDB search
MAEFAEPIARLIDEFRRLPGIGHKSAQRLAFHVLRSSAEDAERLALAITEVKSRMTFCSV
CHNLTDIGQDPCAYCTNPARDQHLLCVVEEPYNVFAIERTGEYKGLYHVLHGALSPLRGI
GPDDIRLRSLLERLRTLEVTEVILATNPTTEGEATANYIGCLLKPIGVRTTRLAMGLPVG
SDLEYADEVTLHKALAYRREM
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttgcggaaccgattgcccgcctgattgacgaattcaggcgattgccgggc
attggccacaagtcagcccaacggctggctttccacgtcctgcgcagtagtgccgaagac
gccgaacggctcgcgctggccatcaccgaggtcaaatcccggatgaccttttgctcggtg
tgccacaacctgacggacatcgggcaggacccttgcgcgtactgtaccaacccggcacgc
gaccagcatctgctctgtgtggtcgaggagccatacaacgtctttgccattgaacgcacc
ggcgagtacaagggcctgtaccacgtcctgcacggggccctgtccccgctccgggggatc
ggcccggacgacatccgcctgcggtcgctgctggagcgcctgcgcactctggaagtgaca
gaagttattctggccacgaacccgaccacggaaggcgaggctacggccaactacatcggc
tgcctgctcaaacccatcggtgttcggacgacacggctggcaatggggctgccggtcggc
agcgaccttgagtacgccgatgaagtcacactgcacaaggcactggcctaccggcgtgaa
atgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system