KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1603Help
Entry
Cabther_A1603     CDS       T01629                                 

Definition
lysophospholipase L1-like esterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cabther_A1603
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Cabther_A1603
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Cabther_A1603
Lipid biosynthesis proteins [BR:ctm01004]
 Fatty acid synthase
  Component type
   Cabther_A1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1931750..1932517
Genome map
AA seq 255 aa AA seqDB search
MKAQRSRVGSFAISLLIISSSLLAGGCSRTGTEAPENLPVLAPAPTDAAPTARPRIVVLG
DSLTAGFGLPREASYPTVLQKKLDAAGLNYQVINAGISGDTSAGGVERLDWSLDGDVRIV
ILALGANDGLRGLPLTQMEANLRTIIERARARGAQVILAGLKAPAEAGPDYGAQFEAVYR
KLAQQYRLPLIPSLLEGVAGREELNQEDGIHPNARGAAIVADNVWKVLEPVARQQLAQSQ
SNPDAPPAAKPAGAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacagcgcagtcgggttggcagcttcgccatcagtcttctcatcatcagcagc
agtctgcttgccggcggatgcagtcgtaccggcacagaagccccggaaaacctgcccgtc
ctggcgccggcgcccacggacgccgcacccaccgcccggccgcggatcgttgtcctcggc
gacagcctgacggccggtttcggcctgccgcgcgaagccagctacccgaccgtgctccag
aagaaactcgatgccgccggactgaactatcaggtcatcaacgccggtatttccggcgac
acctcggccggcggcgtcgaacggctcgactggtcgctggacggcgacgtgcgcatcgtc
atcctcgccctcggcgccaatgacggactgcgcgggctgcccctcacccagatggaagcc
aacctgcgcaccatcatcgaacgtgcccgtgcacgcggagcgcaggtcatcctcgccggt
ctcaaagctcccgctgaagcgggacccgactacggcgcacagtttgaagccgtctatcgc
aaactcgcccagcagtaccggttgccgctcatcccgtccctgctcgaaggcgttgccggc
cgggaagaactcaatcaggaggacggcatccatcccaacgcgcgcggcgcggccatcgtc
gccgacaacgtctggaaagttctcgagcccgtcgcccggcagcagcttgcccaatcgcag
tccaatcccgatgcgcccccggcggccaagccggctggcgcacgataa

DBGET integrated database retrieval system