KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1646Help
Entry
Cabther_A1646     CDS       T01629                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ctm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1973701..1974639)
Genome map
AA seq 312 aa AA seqDB search
MRPVDRAGSDGPRMPMPVVFPSFAKINLSLEVIGRRPDGYHELRTVFQTIDLCDWLEIDI
TDEPAISLTCDEPTLACDERNLVVRAARGLQAATGVRQGARLHLRKRIPMQAGLGGGSSN
AAVTLLALQRLWGVALPVAACQRAAAALGADVPFFLTGGTALGLGRGDDITPLPEVHLPV
IVVVNPGLAIPTGLVFQRLNAGLTDAETVRKLAACLPSRVDWLATGNDLEATVFDAFPLV
REVRDRLFALGAQVARMSGSGSTVFGLFGDAQAGEAARQACLNAGWQAWLVSSVSREVYA
ERLKGTMTGLAW
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcggccggttgaccgggccggttcagacggcccacggatgcccatgcccgttgtgttt
ccatcctttgccaagatcaacctgtcgctggaagtcatcggccggcggcccgacggctat
cacgaactgcgaacggtctttcagacgattgacctctgcgattggctggaaattgacatc
acggacgagccggccatctcgctgacctgcgatgaaccgacactggcctgcgacgagcgg
aatctggtcgtgcgggcggcccgggggcttcaggcggcgacgggggtgaggcagggagca
cgcctgcacctgcggaagcgcatccccatgcaggctggattgggcggcggaagcagcaat
gcggctgtgacgcttctggcgctgcaacgcctgtggggcgttgcccttccggtggcggcg
tgccagcgtgcggccgccgcgttgggcgcggacgtgcccttttttctgaccggcggcacc
gcactcggcctgggccgcggggatgacattacccccctgccggaggttcacctgccggtt
attgtggtcgtcaatccgggactggcgattccgaccggcctggtgtttcagcgtctgaac
gcagggttgacagacgcagagaccgtccgtaaactggcggcttgcttaccaagccgggtg
gattggttggcaactggaaatgacctcgaagcgaccgtttttgacgctttccctctggta
cgggaagtgcgcgaccggttgttcgcccttggcgctcaggtggcccgcatgtcaggcagc
ggcagcacggtgttcggtctcttcggggatgcacaggccggggaggcggcgcggcaggct
tgtctgaacgccggatggcaggcgtggctggtatcctcggtgagccgtgaagtttatgcg
gagcgcctgaagggcacgatgaccggactggcgtggtga

DBGET integrated database retrieval system