KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1665Help
Entry
Cabther_A1665     CDS       T01629                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cabther_A1665
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cabther_A1665
Enzymes [BR:ctm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cabther_A1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1993439..1993999)
Genome map
AA seq 186 aa AA seqDB search
MNFIPTELPGVILIEPKVFRDERGFFLETYHAAKFAQAGLDVTFVQDNHSRSVQGTLRGL
HAQWRRPQGKLVRVIAGEIFDVVVDIRLDSPTFGRWLGVRLSAENFRQLYVPQGFVHGFC
VVSDMAEVLYKCTALYDPGDEIGVIWNDPEIGIDWGIESPLLSEKDRRLPTLRTLVQQLQ
QAPDGV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcattccgacggagctaccgggtgtcatcctgattgagccaaaggtcttccgg
gacgaacgtggttttttcctggaaacctaccatgcggccaagtttgcccaggccggcctg
gatgtgacctttgtccaggacaatcactcgcgttcggtgcagggcacgctgcgcggtctt
catgcccagtggcggcggccgcagggtaagctcgtccgggtcattgcgggggaaattttt
gatgtcgtggtggacatccgtctggattcgccgacctttggacggtggctgggcgtgcgc
ctgtcggctgaaaactttcgccaactctatgttccacagggctttgtccatgggttttgc
gtggtgagtgacatggcggaagtcctttacaagtgcacggcgctctatgaccccggtgat
gagattggcgtcatctggaatgatcccgaaattggcattgactgggggattgagtcgccg
ttgttgtcggaaaaggaccggcggctgccaaccttgcgcacgctcgtgcagcagttgcaa
caagcgccggacggcgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system