KEGG   Chloracidobacterium thermophilum: Cabther_A1746Help
Entry
Cabther_A1746     CDS       T01629                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A1746
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cabther_A1746
   00640 Propanoate metabolism
    Cabther_A1746
   00660 C5-Branched dibasic acid metabolism
    Cabther_A1746
Enzymes [BR:ctm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cabther_A1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2081863..2083023)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKRLLAKFGVPVPRHHVALNAMDACMAAEALGSFPVVLKAQIHAGGRGKGGGV
KLASSLEEVEAIALRMLGHKLVTPQTGPEGRTVHRLIVEEGLHIDRELYLSLLIDRTTSS
PIIMASEAGGMEIEEVAAATPEKILREVIDPALGLQPYQARKVAFGLGFTGSQAGQVVKI
LMALYRAFVESDASLVEINPFLLTKEGDFYALDAKVMLDDNALYRHPDYVELRDTREEEP
LETEAAKYDLNYVKLDGNIGCMVNGAGLAMATMDIIKLAGGHPANFLDIGGGASQERVEQ
AFRILIADPSVRAVLINIFGGIVRCDMVAAGVIEAARNLDVRLPIVVRLEGTNVEQGRAL
LESSGLNFTTASGMRDAAEKVVALAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgaatatcaggccaaacgcctgctggcgaagtttggcgtaccggtgccg
cggcaccacgtggccctcaatgcgatggatgcctgcatggcggccgaagcgctgggttcc
ttcccggtcgtgctcaaggcccagattcacgccggcggccgcggcaaaggcggcggcgtc
aagctcgcttcctcgcttgaggaagtggaagccattgccctgcgcatgctcgggcacaag
ctggtgacaccccagacgggcccggaagggcgcaccgtccaccggctcatcgtcgaagaa
gggctgcacattgaccgcgagctgtacctcagcctgctcattgaccgcaccacatcttcg
cccatcatcatggcaagcgaagccggcgggatggaaatcgaggaagtcgccgcggcaacc
ccggaaaagattttgcgggaagtcatcgatccggcgcttgggttgcagccgtatcaggcg
cggaaagtcgccttcggtctcggctttacgggcagccaggcgggccaggtcgtgaagata
ctcatggcgctctaccgggcctttgtggaaagcgatgcttcactggtcgagatcaatccc
tttttgctcaccaaagaaggggatttctacgcgcttgatgccaaggtgatgctcgatgac
aacgccctgtaccggcatcccgactacgtcgaactgcgcgacacccgcgaagaagaaccg
ctggaaaccgaggctgcgaagtacgatctcaactacgtcaagctggatggcaacattggc
tgcatggtcaacggcgccgggctggcaatggccacgatggacatcatcaagctggctggt
ggtcatccggcaaacttcctcgacattggcggtggggcttcccaggaacgggtcgagcag
gcttttcgcatcctcattgccgatcccagcgtccgggcggtgctcatcaacatttttggc
ggcatcgtccggtgcgacatggtggcggccggagtcatcgaagcggcccgcaacctggat
gtgcgtctgccgattgtcgtccggcttgaaggcacgaacgtcgagcaggggcgcgccctg
cttgaaagttcaggtctgaacttcacgacggccagcggcatgcgggatgccgctgagaag
gtcgttgccctggcagcttag

DBGET integrated database retrieval system