KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A1892Help
Entry
Cabther_A1892     CDS       T01629                                 

Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A1892
   01230 Biosynthesis of amino acids
    Cabther_A1892
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_A1892
   00030 Pentose phosphate pathway
    Cabther_A1892
   00051 Fructose and mannose metabolism
    Cabther_A1892
   00052 Galactose metabolism
    Cabther_A1892
  Energy metabolism
   00680 Methane metabolism
    Cabther_A1892
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cabther_A1892
Protein phosphatases and associated proteins [BR:ctm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cabther_A1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2251672..2252712)
Genome map
AA seq 346 aa AA seqDB search
MEVRTLGVLTGGGDAPGLNAALRAVVRRAMQYGIRVLGIHQGWNGLIHGRVEPLTRYSIS
GILPRGGTILGTSRVNPLETDEVAERIRANWRKYELDALVVIGGEGTLSAALEMHRRYGY
PIVGVPKTIDNDLCGTDMTFGFDTALSVATEAIDRLHTTAESHDRVMVVEVMGRHAGWIA
AGAGIAGGADIILVPEHPFRISEVCQILNHRKSLGRFFSIIVVAEDAHPHPDEDFLTPEE
KERVFQHTRLGGIGHLLARKIEELTGIETRVTVLGYTQRGGVPTAYDRLLATRLGVKAVD
MVRASEFGCMAALQGMRMVSVPIEQAVSCIKRLDDELYETARVFFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcgtacgttgggtgtattgaccggtggtggggatgcccccggactcaatgcc
gcgctgcgtgccgttgtccgtcgcgccatgcagtacgggatacgggtgctgggcattcat
cagggatggaacggtctcattcacgggagggttgagccgctgacccggtattccatttcg
ggcatcctgccccggggcgggacgattctcggcacgtcgcgggttaatcccctggaaact
gacgaggtcgccgaacggatacgcgccaactggcgcaagtacgaactcgatgcgctggtg
gttatcggcggcgaaggcaccctcagcgctgcgctggagatgcaccgccggtatgggtat
ccgattgttggcgtaccaaagacgattgacaacgatctgtgcgggacggacatgaccttc
ggtttcgatacagcgctgtccgtggcgaccgaggccattgaccggctgcacaccacggcg
gaatcccacgaccgcgtcatggtagttgaagtcatgggacgccatgccggatggattgcg
gccggggccgggattgctggcggcgccgacatcatcctcgtcccggagcatccgtttcgg
atcagcgaggtgtgccagattctcaatcaccggaagtcgctggggcggtttttttccatc
atcgttgtggccgaggatgcccatccgcatcccgacgaggactttctcacgcccgaagaa
aaggaacgtgtctttcagcacacccgcctgggaggcatcgggcacctgctggcgcggaag
attgaggaactgacaggcatcgaaacgcgggtgacggtgctgggctacacgcagcgtggc
ggtgtgccgacggcttatgaccgtttgctggcaacccggttgggtgtcaaggccgtggac
atggtgcgcgccagcgagtttggctgtatggcggcgcttcagggcatgcgtatggtttcc
gtgccgattgaacaggccgtttcctgcatcaaacgtctggatgatgaactgtatgagaca
gcacgtgtcttcttcgggtaa

DBGET integrated database retrieval system