KEGG   Chloracidobacterium thermophilum: Cabther_A1895Help
Entry
Cabther_A1895     CDS       T01629                                 

Definition
(GenBank) Transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00010  Glycolysis / Gluconeogenesis
ctm00052  Galactose metabolism
ctm00500  Starch and sucrose metabolism
ctm00520  Amino sugar and nucleotide sugar metabolism
ctm00521  Streptomycin biosynthesis
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01120  Microbial metabolism in diverse environments
ctm01130  Biosynthesis of antibiotics
ctm01200  Carbon metabolism
Module
ctm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_A1895
   00052 Galactose metabolism
    Cabther_A1895
   00500 Starch and sucrose metabolism
    Cabther_A1895
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A1895
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cabther_A1895
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cabther_A1895
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cabther_A1895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEP12641
UniProt: G2LGC8
Position
1:complement(2254712..2255635)
Genome map
AA seq 307 aa AA seqDB search
MWIGIECAATFLRGIVCEASGEVITQRQRPLTGHAPAEAVAAVRALVAELAATESDPALF
GGVGLALPGNLNRATDRCESNTLWSSVVLDELRPCGALGTARLVSRATAALLGEYRCGVA
QGCQTVVYVEVGPELSAAMLHAGQLWTGATGIAGAIGYDSVDVDGDLTLQERVGSEGLIR
RAKERMYRDRTSSLSRRGIPRDREIGLEDLLTMARLGDELAQVIIARAGVHLGIAAARLI
NLLNPELLIIGGDLVSAGEVLLAPIRAEVERRTAPSALAVCRLLPATVGAAVGAAQAARQ
EALSTAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgtggattgggatagagtgcgcggccacgtttctccggggcattgtctgtgaagcgagc
ggggaagtcatcacgcagcgtcagcgaccgctgaccgggcatgcgccagcggaagctgtg
gctgccgtgcgtgcccttgtcgccgaactggcggcgactgagtccgatccggcgttgttt
ggcggtgtcggactggcgttgccgggcaatctcaaccgggcgaccgaccggtgcgaatcg
aacacgctctggtcgtccgtggtcctggatgagcttcggccgtgcggtgccctgggaacg
gcccgtctggtctcgcgggcgacagccgctctgctcggcgaataccggtgcggcgtggcc
cagggctgccagacagtggtctatgttgaagtcggaccggaactttcggcggccatgctc
cacgccgggcagctctggacaggagcaacggggattgccggtgccattggttacgattcg
gtggacgtggacggcgacctcaccctgcaggaacgggtcggcagcgaagggctgattcgg
cgggccaaagagcggatgtaccgtgatcgtacttcttcgctctcccggcgcggcatccca
cgggaccgggaaattggccttgaggacctgctcaccatggcacgcttgggggatgagctg
gcacaggtcatcattgcccgcgccggagttcacctgggcatagcggcagcacgccttatc
aacctgctcaatcctgagctgctcatcattgggggcgacctggtttccgctggcgaggtt
ctgctggctccaatccgtgcggaagtcgagcgccggacagcaccttcggcgctggccgtg
tgtcgtttgctgccggccacggtgggcgcggcggtgggggctgcccaagccgcccgtcag
gaggcgttgtccacggcagcctag

DBGET integrated database retrieval system