KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A2066Help
Entry
Cabther_A2066     CDS       T01629                                 

Definition
helicase , RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cabther_A2066
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cabther_A2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2451167..2453368)
Genome map
AA seq 733 aa AA seqDB search
MNNSRPPSVLVGAVERVTYTNPETGYTVLRLRVNGEREAVTVVGYFPALSPGATLRLSGF
WTTHPTHGPQFKATQHEVTQPATLAGIEKYLGSGLIKGIGPVTARRIVAHFREATLQIIE
TDIHRLSEVPGIGRKRVELIAQAWEAQRAIKDVMLFLQSHGVSTHYAAKIYRQYGARAIQ
TVIENPYQLARDIYGVGFKTADAIAANLGIAPDAEMRLRAACLHVLQEAADQGHCFLPES
RLLASLQTLLGVTDAERLHAVLATLTAEAELVARPPAPPNVLEASYHLPYLFYAEQHIAR
LLRGLTLRPLTQLEAPARQWLDAYAARESLQLSPEQQQAVLTAATQRVAVVTGGPGCGKT
TTLRAIVGLFRWLGLRVELATPTGRAAQRLSEVTGVEARTLHRLLAYDPARGRFTHDSDY
PLDTDAVIVDEASMLDAPLAAALLKAMPARGRLLLVGDVDQLPSVGPGRVLGDIIAAGVV
PVCRLTQVFRQAEGSAIIQNAHRIRAGQFPRLIRPDGRTTTDCYFVAADTPADIQARLEQ
VVASLSRRFGYDPVNDIQVLTPMNRGEIGAVELNRRLQQALNPLRPGQPEIERLGRRFRV
GDKVVQRVNNYTREVFNGDIGRIVDIQLEDQTLTVNYDGRCVTYDWADVNELSHGFALSV
HKSQGSEYPAVVIVLHTQAFPVLSRNLLYTALTRAKRTAVLLGTTRAIGLAVRQVEAARR
YTWLAEALREPIR
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactcccggccgccttcggttctcgttggtgccgtcgagcgtgtgacttatacc
aacccggaaacaggctacacggtgttgcgcctccgggtgaacggtgagcgtgaggccgta
acggtggtcgggtacttcccggcactgtcgccaggggcgacgctccgtttgtccgggttc
tggacgacccatcccacgcacggcccgcaattcaaagctacccagcacgaagtcacccag
ccggcaacgctggccggcatcgagaaatacctgggttccggtctcatcaaagggatcggc
cctgtcacggcccggcgcatcgttgcccacttccgggaagccacattgcagatcatcgag
acggacatccaccgcctgagcgaagtgcccggcatcggccgcaagcgcgttgagctgatt
gcacaggcctgggaagcacagcgcgctatcaaagacgtgatgctgtttttgcagtcgcat
ggcgtctccacccactatgccgccaagatatacaggcagtatggggcccgtgcgattcag
accgtcatcgaaaatccctaccagcttgcgcgggacatctacggggtgggtttcaaaacc
gccgacgcgattgcggccaatctgggcatagcgccggatgcggaaatgcgtctgcgggcg
gcctgcctccacgtgcttcaggaagccgccgaccaggggcactgttttctgccagaaagc
cggctgctcgcctccctgcaaacgcttctgggcgtgactgatgccgagcgcctgcacgct
gtcttggcaactctgaccgccgaggccgaactggtggcccgtccgcccgcgccgcctaac
gtgctggaagcgagttatcacctgccgtacctgttttatgccgagcagcatattgcgcgg
ctgctgcgtggtctcaccctgcgtcccctgacccaactggaagcaccggcgcggcagtgg
ctggacgcctacgcggccagggagtcgctgcaactgtcgccggagcagcagcaggccgtg
ctgacggcggcaacgcagcgcgtggcagtggttacgggcggccccggctgtggcaagaca
acgacgttgcgggccatcgttggtttgttccgctggcttgggctgcgggttgagctggcg
acaccgaccggacgcgctgcccagcggctttccgaagtgaccggcgtcgaggcgcgtacc
ctgcatcggctgctggcctacgatccggcccggggacgcttcacccacgacagcgattac
ccactcgacacggatgccgtcatcgtggacgaagcctcgatgctcgacgccccactggct
gcggcgctgctcaaggccatgccggcgcggggccggctgctgctcgtgggggatgtggac
cagttgccttccgtcggcccgggccgggtgctgggggacatcattgccgccggagtcgtg
ccggtctgccgtctgacccaggtgtttcgccaggccgaggggagcgccatcatccagaat
gcccaccggattcgggcagggcagtttccccggctcatccgaccggatggccggacaacc
accgactgctatttcgtggcggccgacaccccggcagacatccaggcgcgactcgaacag
gttgtggcgagtctgtcccggcgttttgggtacgacccggtgaacgacatccaggtgttg
acgcccatgaaccggggggagatcggtgccgtcgaactcaaccggcgcttacagcaggcg
ctcaatccgctgcgtccggggcagcctgaaatcgagcgtctgggacgccgcttccgggtc
ggggataaggtcgtgcagcgtgtcaacaactacacccgcgaagtcttcaacggcgacatc
gggcgcatcgtggacatccagcttgaggatcaaaccctgaccgtgaattacgacgggcgg
tgcgtcacttatgattgggcggatgtcaacgaactcagccacggctttgccctttccgtc
cacaaaagccaggggtcggagtatccggcggtggtgattgtgctgcatacgcaggcgttt
ccggtgctgagccgcaacctgctctacacggcgctgacgcgcgccaaacggacggcggtg
ctgctgggaacaacccgtgccattggcttggccgtgcggcaggtggaagccgcccgacgc
tacacctggctggcggaggcgctgcgtgaacccatccggtag

DBGET integrated database retrieval system