KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A2158Help
Entry
Cabther_A2158     CDS       T01629                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cabther_A2158
Enzymes [BR:ctm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cabther_A2158
Exosome [BR:ctm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cabther_A2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2555572..2556552
Genome map
AA seq 326 aa AA seqDB search
MLVLPERPRRNRRTEAIRRMVRETSLTPAHLVAPLFVVDGDRERQPIPSMPGYERLSIDL
LLEKCRQLADLGIGGVALFPALPAYKKDKTASEATNPDGLFPRAVSAVKEQVPELTIFTD
VALDPYSCDGHDGLVSETGEILNDETVEVLARMAVLHARAGADYVAPSDMMDGRVGAIRE
ALDVEGFHNVGIMAYSAKYASAFYGPFRDALDSVPKFGDKKTYQMDPANVREALREVRLD
LAEGADMVMVKPALAYLDVIRAIWEISDVPITAYQVSGEYAMVKAAAERGWIDGDRVMLE
ILLAIRRAGADVIFTYFAEEAAQQLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtacttcctgaacggccacggcgtaaccggcgcacggaagccatccgccgcatg
gtacgcgaaacctcgctcacgccggcgcatctggtcgcgccgttgtttgttgttgacggc
gaccgcgaacgccagcccattccctcaatgccgggctatgaacggctttcgatagacctg
ctgctggaaaagtgccgccagcttgccgaccttggtattggcggcgttgccctgtttccg
gcgctgccggcatacaaaaaggacaaaaccgcctcggaagccaccaacccggacggtctc
tttccgcgtgcggtcagcgccgtcaaggagcaggtgccggaactgaccattttcaccgac
gtggcgctcgacccctattcctgcgacggtcacgacgggctggtctcggaaacgggtgaa
atcctcaacgatgaaaccgtcgaagtgctggcccggatggccgtgctccacgcccgcgct
ggcgccgattacgtagcgccgtccgacatgatggacgggcgggttggggccattcgggaa
gccctcgatgtcgaaggctttcacaatgtgggcatcatggcatactccgccaagtacgcc
tcggccttctacggcccgttccgggacgcgctcgattcggtgcccaaatttggcgacaag
aagacctaccagatggacccggccaacgtccgggaagccctgcgggaagtacggctcgat
ctggccgaaggcgcggacatggtgatggtcaaaccggcgctggcttacctcgatgtcatc
cgggcgatctgggaaatttcggacgtgcccatcacggcctaccaggtcagcggcgaatac
gccatggtcaaggccgcggccgagcggggctggattgatggcgaccgcgtcatgctcgaa
atcctgctggccattcgccgggctggggccgatgtcattttcacctactttgccgaggaa
gccgcacaacagttgggatga

DBGET integrated database retrieval system