KEGG   Chloracidobacterium thermophilum: Cabther_A2192Help
Entry
Cabther_A2192     CDS       T01629                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cabther_A2192
   01230 Biosynthesis of amino acids
    Cabther_A2192
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_A2192
   00051 Fructose and mannose metabolism
    Cabther_A2192
   00562 Inositol phosphate metabolism
    Cabther_A2192
Enzymes [BR:ctm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cabther_A2192
Exosome [BR:ctm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cabther_A2192
  Exosomal proteins of bladder cancer cells
   Cabther_A2192
  Exosomal proteins of melanoma cells
   Cabther_A2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2590887..2591663)
Genome map
AA seq 258 aa AA seqDB search
MVLRTPLIIGNWKMHKTVAEAVAYVTTFLPHIAQVTGIEIGIAPVFTALSSVVAAAAGSA
LRVLAQNVAAEGPTGAFTGEVAAEMLREVGCYGVIVGHSERRRYYGETDTVVAAKVRRAL
NAQLLPVACIGETLEEREAGTALSVVERQLRAIAGTLTPDEAPRIVLAYEPVWAIGTGRA
ATPEVVQVMHRHLRATWEECFGAPAAEALRILYGGSVTADNIAAFTSLPDVDGALVGGAS
LSPNGFAQLIQRSQVASA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttctacgtaccccgctcatcatcggaaactggaaaatgcacaagacggtcgcggag
gccgtcgcctatgtgactacctttctcccccacatcgcccaggtcacggggattgagatt
ggaattgccccggtgttcacggcgctctcctccgtggtggcggcggctgcggggagcgct
ctgcgggtgttagcccagaatgtggctgccgaaggtccaaccggagcctttactggagaa
gtggccgccgaaatgctccgcgaagtcggttgttatggcgtcattgtcgggcactccgag
cggcgccgttactacggcgaaaccgacaccgtcgtggcggccaaggtgcgacgtgccctc
aatgcacaacttctgcccgtagcctgcataggcgagacactggaggaacgggaagccgga
acggcgctgtccgtcgttgagcggcagctccgggccattgccggtacgttgacaccggac
gaagccccccgtatagtgctcgcttatgagccggtatgggcaatcggcacgggccgggcc
gccacgccggaagtggtgcaggtgatgcaccggcatctgcgggccacctgggaagagtgc
tttggcgcgccagcggcagaggcactgcgtattctgtacggcgggagcgtgacggctgac
aacatcgcggcgtttacgtccttgcccgatgtggacggagcgctggtgggcggggcgagc
ctctcgccgaacggttttgcccaactcatacagcggtcgcaggtggcctcggcgtag

DBGET integrated database retrieval system