KEGG   Chloracidobacterium thermophilum: Cabther_B0025Help
Entry
Cabther_B0025     CDS       T01629                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00260  Glycine, serine and threonine metabolism
ctm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01130  Biosynthesis of antibiotics
ctm01230  Biosynthesis of amino acids
Module
ctm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cabther_B0025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cabther_B0025
Enzymes [BR:ctm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cabther_B0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PA
Motif
Other DBs
NCBI-ProteinID: AEP13033
UniProt: G2LJL6
Position
2:complement(33303..34118)
Genome map
AA seq 271 aa AA seqDB search
MNRYAARFAALRQAGRKAFIPFTVLGFPDRARCLASIEAMLAGGATALELGIAFSDPIAD
GPVIQQATHDVLASGFGVDDALALIAQVRQRDADIPIGLLVYHNTVAAREAGRFFADVRA
AGADGVLIADLPPEMAHETTAAAKQAGIAPIFMVSPLTDAARLERLAALAEGFLYVVSRL
GITGSQTHFDNQLRATLERARAVVDLPLCVGFGVSTPAAAQHMVALGADGVITGSRIIEI
IRAAGEDFGPAVEQFCRTMQAAVDGTAVQAV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggtatgccgcgcggtttgccgcgcttcgccaggctggacgaaaagccttcatt
cccttcaccgttctcggcttccctgaccgggcgcgctgcctggccagcatcgaggccatg
ctggccggcggcgcgacggcgctggaactgggcattgccttcagtgacccgattgccgat
gggccggtcatccagcaggccacccacgacgtgctggcgtccggtttcggagttgacgat
gcgctggcgctcatcgcccaggtacggcaacgggatgccgacattcccattggtctgctg
gtctatcacaacacggtggcggcccgtgaggccgggcggttttttgccgatgtacgcgca
gccggcgcggatggtgttctcattgccgacctgccgccggaaatggcccacgagacgacg
gctgccgccaaacaggccggcattgcgccgatttttatggtctctccgctgaccgatgct
gcgcggttggagcggttggctgcactggcggagggctttctctatgtcgtctcccgcttg
ggcatcaccggcagccagacgcacttcgacaaccaactccgggcgacgctggagcgggcg
cgcgccgttgtggacctgccgctctgtgtcggattcggggtttcgacgccggcggccgcg
caacacatggtggcgctcggcgcggatggggtcatcaccggctcgcggatcattgaaatc
atccgcgccgccggggaagacttcgggccggcagtggagcagttctgccgcacgatgcag
gctgcggtggatggcacggccgttcaggccgtgtag

DBGET integrated database retrieval system