KEGG   Chloracidobacterium thermophilum: Cabther_B0025Help
Entry
Cabther_B0025     CDS       T01629                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cabther_B0025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cabther_B0025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cabther_B0025
Enzymes [BR:ctm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cabther_B0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(33303..34118)
Genome map
AA seq 271 aa AA seqDB search
MNRYAARFAALRQAGRKAFIPFTVLGFPDRARCLASIEAMLAGGATALELGIAFSDPIAD
GPVIQQATHDVLASGFGVDDALALIAQVRQRDADIPIGLLVYHNTVAAREAGRFFADVRA
AGADGVLIADLPPEMAHETTAAAKQAGIAPIFMVSPLTDAARLERLAALAEGFLYVVSRL
GITGSQTHFDNQLRATLERARAVVDLPLCVGFGVSTPAAAQHMVALGADGVITGSRIIEI
IRAAGEDFGPAVEQFCRTMQAAVDGTAVQAV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggtatgccgcgcggtttgccgcgcttcgccaggctggacgaaaagccttcatt
cccttcaccgttctcggcttccctgaccgggcgcgctgcctggccagcatcgaggccatg
ctggccggcggcgcgacggcgctggaactgggcattgccttcagtgacccgattgccgat
gggccggtcatccagcaggccacccacgacgtgctggcgtccggtttcggagttgacgat
gcgctggcgctcatcgcccaggtacggcaacgggatgccgacattcccattggtctgctg
gtctatcacaacacggtggcggcccgtgaggccgggcggttttttgccgatgtacgcgca
gccggcgcggatggtgttctcattgccgacctgccgccggaaatggcccacgagacgacg
gctgccgccaaacaggccggcattgcgccgatttttatggtctctccgctgaccgatgct
gcgcggttggagcggttggctgcactggcggagggctttctctatgtcgtctcccgcttg
ggcatcaccggcagccagacgcacttcgacaaccaactccgggcgacgctggagcgggcg
cgcgccgttgtggacctgccgctctgtgtcggattcggggtttcgacgccggcggccgcg
caacacatggtggcgctcggcgcggatggggtcatcaccggctcgcggatcattgaaatc
atccgcgccgccggggaagacttcgggccggcagtggagcagttctgccgcacgatgcag
gctgcggtggatggcacggccgttcaggccgtgtag

DBGET integrated database retrieval system