KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0025Help
Entry
Cabther_B0025     CDS       T01629                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cabther_B0025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cabther_B0025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cabther_B0025
Enzymes [BR:ctm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cabther_B0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(33303..34118)
Genome map
AA seq 271 aa AA seqDB search
MNRYAARFAALRQAGRKAFIPFTVLGFPDRARCLASIEAMLAGGATALELGIAFSDPIAD
GPVIQQATHDVLASGFGVDDALALIAQVRQRDADIPIGLLVYHNTVAAREAGRFFADVRA
AGADGVLIADLPPEMAHETTAAAKQAGIAPIFMVSPLTDAARLERLAALAEGFLYVVSRL
GITGSQTHFDNQLRATLERARAVVDLPLCVGFGVSTPAAAQHMVALGADGVITGSRIIEI
IRAAGEDFGPAVEQFCRTMQAAVDGTAVQAV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggtatgccgcgcggtttgccgcgcttcgccaggctggacgaaaagccttcatt
cccttcaccgttctcggcttccctgaccgggcgcgctgcctggccagcatcgaggccatg
ctggccggcggcgcgacggcgctggaactgggcattgccttcagtgacccgattgccgat
gggccggtcatccagcaggccacccacgacgtgctggcgtccggtttcggagttgacgat
gcgctggcgctcatcgcccaggtacggcaacgggatgccgacattcccattggtctgctg
gtctatcacaacacggtggcggcccgtgaggccgggcggttttttgccgatgtacgcgca
gccggcgcggatggtgttctcattgccgacctgccgccggaaatggcccacgagacgacg
gctgccgccaaacaggccggcattgcgccgatttttatggtctctccgctgaccgatgct
gcgcggttggagcggttggctgcactggcggagggctttctctatgtcgtctcccgcttg
ggcatcaccggcagccagacgcacttcgacaaccaactccgggcgacgctggagcgggcg
cgcgccgttgtggacctgccgctctgtgtcggattcggggtttcgacgccggcggccgcg
caacacatggtggcgctcggcgcggatggggtcatcaccggctcgcggatcattgaaatc
atccgcgccgccggggaagacttcgggccggcagtggagcagttctgccgcacgatgcag
gctgcggtggatggcacggccgttcaggccgtgtag

DBGET integrated database retrieval system