KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0031Help
Entry
Cabther_B0031     CDS       T01629                                 

Definition
glucoamylase-like glycosyl hydrolase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cabther_B0031
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Cabther_B0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:43539..45677
Genome map
AA seq 712 aa AA seqDB search
MKLVSIVLAVALVCPGLFSLSPSGDATREAPGRPGVKSTWTSGGKLGVGTAVSRRSRVWF
TLGATGLTEVYYPTVDMPNLRALDFVIVGNGYVGCASRDALERETRRTRDDALSFAQTMS
DGKRWRITQRYACDPNRDALLIEVEVTALDGGNYEVFALLDPAVANSGLGDTGEHRGRTL
VASDRDATTNQTIAMAFAAQPAFEVVSSGFAGVSDGWTDLAADGRLDGREQRAVDGNVVQ
IGKLSAPRTTLALAFADRPEAAADVAAAALAEGFAAIAGRYEAEWQAFTARLPRVAAEYR
AQFAVAAMTLLAHEDKTYPGAGVASLSIPWGEAADADRPTSGGYHLVWSRDLYHVATAWL
ALGDRAAAGRALDYLFKVQQNADGSFPQNSWLDGRPYWPSVQLDEVAYPIILAWQLERFD
RETYTQHVRPAAEYILRHGPYTPQERWEEEEGYSPSTIAAEIAGLICAADIARRLGRAED
AERYERTADRWAEGVQQWCYTTTGPWDEGEAERGYYLRINNNRDPNDGFKLDINNGGGQH
DERAIVDAGFLELVRLGIVPPDDPKILRSLRMVDRVIRVETPMGPGWRRYNYDGYGERAD
GSGWQDKGIGRIWPLLTGERGEYVIASGGDANPYAKTMLAFAGPTGMIPEQVWDQAYPPD
TRYRIGQGTGSATPLAWSMAQFVRLVMCIEARRVVEQPAVVFQRYAGKQRPR
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggtaagcatcgtgcttgccgtggcgctggtctgtccggggctgttttccctg
tcgccatcgggagacgcaacaagagaggctccgggccggcccggcgtcaagtccacgtgg
acttccggcggcaagctgggcgtgggcacggccgtcagtcggcgatcacgggtgtggttc
accctgggcgcaacgggcctgacggaggtctattacccgacggtggatatgcccaacctg
cgggcgctggattttgtcatcgtcggcaacgggtacgttgggtgtgcgtcccgcgatgcc
ttggagcgggagacgcgccggacccgcgacgatgccctgtcctttgcccagaccatgagc
gacggcaagcggtggcgcatcacacagcgttatgcctgtgaccccaaccgcgatgcgctg
ctcatcgaagtcgaagtcacggcgctggacggcggcaactacgaggtctttgccctgctt
gacccggccgtggccaacagtggcctgggagatacgggcgaacaccgcggccggacgctc
gtcgcttccgaccgcgatgccacaaccaaccagaccattgccatggcgttcgccgcacag
ccggcctttgaggtggtgtcgagtggctttgccggggtcagcgacggctggaccgatctg
gctgccgacggacggctggacggacgtgaacagcgcgccgtggatggcaacgtcgtgcag
attggaaagttgtctgcaccccggacgactttggcactggcctttgccgaccgcccggaa
gcggcggccgatgttgccgcagcagcgctggccgagggctttgccgccattgccgggcgt
tacgaagccgaatggcaggcctttacggcgcggttgccacgggtggctgccgaataccgc
gcccagtttgccgtggccgccatgaccctgctggcccacgaggacaaaacctaccctggc
gcgggcgtcgccagcctgagcattccctggggggaagccgctgatgccgaccgcccgacc
tccggtggctatcatcttgtctggtcgcgtgacctctaccacgtcgccaccgcctggctg
gcccttggcgaccgtgccgccgccggccgcgccttggactaccttttcaaggtgcagcag
aacgctgacggcagttttccgcagaatagctggctggatgggcgtccctactggccgagc
gtccagcttgacgaagtggcctaccccatcatcctggcctggcaactcgaacgctttgac
cgcgagacctacacccagcacgtccggccggccgccgaatacatcctgcgccatggcccc
tacacgccacaggagcggtgggaggaggaagagggctattccccttccacgatagccgcc
gaaatcgccggtctgatctgcgcggcagacattgcccggcggctgggccgcgctgaagac
gccgaacgctatgagcgcacggctgaccgctgggccgaaggcgtccagcagtggtgctac
acaacgaccggcccgtgggacgaaggtgaagccgaacgggggtactacctgcgcatcaat
aacaaccgcgacccaaacgacggtttcaagctcgacatcaacaacggcggcggccaacac
gatgagcgcgccatcgtggatgcgggttttctggaactcgtacggttgggcatcgtaccg
cccgacgaccccaaaatcctgcgttcactgcggatggttgaccgggtgattcgggttgaa
acgcccatggggccgggctggcgacgctacaactacgacgggtatggcgagcgcgccgac
ggcagcggctggcaggacaaaggcatcgggcgtatctggccgttgttgaccggcgagcgc
ggcgaatacgtcattgccagcggcggcgatgccaatccctacgcgaaaaccatgctggcc
tttgccggcccaacggggatgatccctgaacaggtttgggatcaggcatatccgcccgat
acccgctaccggataggtcagggcacgggcagcgccacgcctctggcctggagcatggcg
cagttcgtgcggctcgtgatgtgcatcgaagccaggcgggtcgtcgaacagccggccgtg
gtctttcagcggtacgccggaaagcaacgcccccgctga

DBGET integrated database retrieval system