KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0051Help
Entry
Cabther_B0051     CDS       T01629                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cabther_B0051
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cabther_B0051
   00600 Sphingolipid metabolism
    Cabther_B0051
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cabther_B0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(74902..76512)
Genome map
AA seq 536 aa AA seqDB search
MRFLISVLLLGLLAWPWPVVHAARAVRPVKTTAVEVRAEEPPAEPSYPDIAANDEPTPRL
NGPRVVGTTPGREFIYRLPVTGAAPLTCTVTNLPPGLTFDAATGVIRGRVEKEGTTPVAI
TVRNRYGTARATLRIVAGRNKLALTPPMGWNSWNVWGTQVSDEKVRAAAEALERTGLAAC
GYRYVCIDDGWQGRRTPEGVMQPNERFPDMKALGDWLHARGFLFGMYTSPGPFTCGRYLG
SWRHEEADARLYASWGVDYLKHDWCSYEGIARQKTPEVLQQPYIVMRAALDKTDRDIVYA
ICQYGMGEVWTWARQPNIGGNLWRTTGDIEDTWQSVSEIGFRHSPLARFAGPGGWNDPDM
LVLGVVGWGEKTRPTRLTPDEQITHMTLWALLAAPLILGCDLTRLDEFTRRLLTNPEVIG
IDQDELGVPATRRDTAQDGTEVWARPLADGRLAVGLFNRSNDTQTVTANWRDLGLRGRCT
VRDVWQRRDVGTFDQVFAALVPPHGARLLLLRPQPTAPRSPRRTATPPANQHGNGN
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttcttatcagcgtgctgttactgggtctgttggcctggccgtggccggttgtc
cacgccgcgcgggcggtccgtccagtgaaaaccacggctgtagaggtcagggcggaagag
cctccggccgaaccaagctacccggacatcgcggccaacgacgaaccgacgccacgcctc
aacggccctcgtgtggtgggcacgacgccggggcgcgagttcatctaccgcctgcccgta
accggcgccgccccgctgacctgcaccgtcaccaatctgccgcccggcttgaccttcgat
gccgccacaggggtcatccgcggccgggtcgaaaaggaagggacgacaccggttgcgatt
accgtacgcaaccgctacggcacggcgcgggccacgctgcgcatcgtcgctggccggaac
aaactggcgctgacaccaccaatgggctggaactcgtggaacgtctggggcacacaggtt
tcggacgaaaaggtacgcgccgccgccgaagcccttgagcgcacgggactggcggcttgt
ggttatcgttatgtctgcattgacgatggctggcagggccgccgtacgccagagggtgtc
atgcagcccaatgaacgattcccggacatgaaagcccttggcgactggctgcatgccaga
ggcttccttttcgggatgtacacctcgccagggccgtttacctgcgggcgctaccttggt
agttggcgacacgaggaagccgatgcccggctgtatgccagttggggtgtggattacctc
aagcatgactggtgttcctacgagggcattgcgcggcagaagacaccggaggtgctgcag
cagccatacatcgtgatgcgggcggcactcgacaaaaccgaccgcgacatcgtttatgcc
atctgtcaatacggtatgggtgaagtgtggacgtgggcgcgccagcccaacattggcggc
aacctctggcggacaacgggcgacatcgaagacacgtggcaaagcgtctcggagattggg
tttcgacactcgccgctggcgcggtttgccgggcccggcggctggaatgacccggacatg
cttgtgctgggggttgtcgggtggggggaaaagacccgtccgacgcgcctgacgccggac
gaacagattacgcacatgacgttgtgggcgctgctggcagccccgctcatcctgggttgt
gatctgacccggctggatgagttcacccggcggctgctgacgaatcccgaagtcattggc
attgaccaggacgagttgggcgtaccagccacccggcgcgatacagcacaggatggaacg
gaagtctgggcgcgtccgctggctgacggccgtctggcggtcgggttgttcaaccgcagc
aacgacacgcagacggttacagcgaactggcgtgacctgggattgcgcgggcgctgtact
gtacgggatgtgtggcagcggcgtgatgtcgggacgtttgaccaggtgtttgccgcgctc
gtaccgccacatggcgcgcggttgttgcttttgcgcccccagccgacagcgccacgctcc
ccacggcggacggccacgccgcccgccaaccagcacgggaacgggaactga

DBGET integrated database retrieval system