KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0065Help
Entry
Cabther_B0065     CDS       T01629                                 

Definition
O-acetylhomoserine sulfhydrolase (EC:2.5.1.49)
Orthology
K01740  
O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ctm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:88160..89479
Genome map
AA seq 439 aa AA seqDB search
MAEYHFDTLALHGGYAPEATTKARALPIYQTTSYQFDDADHAARLFALKEFGNIYTRLMN
PTTDVFEKRLAALEGGVAALATASGQAAETLAITTIASAGDNIVSTNSLYGGTYNLFRYT
LPKLGITVKFVDADDFAGIEQLIDERTKAIYSETLGNPNLLVTDIERLAEIAHRHGLPLI
IDNTAASPALCRPIEHGANIVIESATKFIGGHGTSIGGVIIDGGNFDWKASGRFPDFTTP
DPSYHGIVYTEAFGHLAFIIKARVQGLRDTGAALSPFNAFLLAQGTETLSLRMARHSENA
LAVANFLKNHPHVAWVNYPGLAEGEQKARVEKYLPKGAGALVTFGIQGGYEAGKRFINSV
RLFSLLANIGDAKSLVIHPASTTHSQLSEEEQRATGVTPEMIRLSVGIEDIRDILADLDA
GLRSAVISESPAAAQSATA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcggaataccacttcgataccctggcccttcacggcggctacgcgcccgaggcaaca
acgaaagcccgcgccctgcccatttaccagacgacctcgtaccagttcgacgatgccgac
catgctgcgcggctgttcgcactcaaggagtttggcaacatctacacgcggttgatgaac
cccacgaccgacgtgttcgagaagcgcctggccgcgctcgaaggtggagtggctgcgctg
gcgacagcttccgggcaggcagccgaaacgctggccatcaccacgatcgccagcgccggt
gacaacatcgtttcgaccaactcactctacggcgggacgtacaacctgtttcgctacacc
ctgcccaagctgggcatcaccgtgaagtttgtggatgccgacgactttgccggcatcgag
cagctcatagacgaacgcaccaaggccatctactcggagaccctgggcaacccgaacctg
cttgtgaccgacatcgaacgccttgcagagattgcccatcgccatggactgccgctcatc
attgacaacaccgcggcttcaccggcgctgtgccgtcccatcgagcacggcgcaaacatt
gtcatcgagagcgccacgaaattcatcggcggtcacggaacgagcatcggcggggtcatc
attgacggaggcaacttcgactggaaggcttccgggcgttttcccgatttcacgacgccc
gatccgtcctaccatggcatcgtttatacggaagcctttggccatctggccttcatcatc
aaggcgcgggtgcagggcctgcgggataccggcgcggcgctgtcgcccttcaacgccttc
ctgctggcgcaagggacggaaacgctctccctgcgcatggcgcgtcattcggaaaacgcc
ctcgctgtcgccaacttcctcaaaaaccatccccacgtcgcttgggtcaactatccgggt
ctggcggaaggcgaacagaaggcgcgggtagagaagtatctgcccaagggggccggggcg
ctcgtgaccttcgggattcagggcggttacgaggccggcaagcgcttcatcaattcggtc
aggctgttcagcctgctggccaacatcggcgatgccaagtccctggtcattcatccggct
tcaaccacgcattcccagctttccgaagaagaacagcgggcgacaggtgtgacgccggag
atgatccggctctccgtcgggattgaggacatccgcgacatcctggccgaccttgacgcc
gggttgcgcagcgccgtcatttcggaatcgccagcggcggcgcaatcggccacggcctga

DBGET integrated database retrieval system