KEGG   Chloracidobacterium thermophilum: Cabther_B0065Help
Entry
Cabther_B0065     CDS       T01629                                 

Definition
(GenBank) O-acetylhomoserine sulfhydrolase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00270  Cysteine and methionine metabolism
ctm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cabther_B0065
Enzymes [BR:ctm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     Cabther_B0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEP13071
UniProt: G2LJQ4
Position
2:88160..89479
Genome map
AA seq 439 aa AA seqDB search
MAEYHFDTLALHGGYAPEATTKARALPIYQTTSYQFDDADHAARLFALKEFGNIYTRLMN
PTTDVFEKRLAALEGGVAALATASGQAAETLAITTIASAGDNIVSTNSLYGGTYNLFRYT
LPKLGITVKFVDADDFAGIEQLIDERTKAIYSETLGNPNLLVTDIERLAEIAHRHGLPLI
IDNTAASPALCRPIEHGANIVIESATKFIGGHGTSIGGVIIDGGNFDWKASGRFPDFTTP
DPSYHGIVYTEAFGHLAFIIKARVQGLRDTGAALSPFNAFLLAQGTETLSLRMARHSENA
LAVANFLKNHPHVAWVNYPGLAEGEQKARVEKYLPKGAGALVTFGIQGGYEAGKRFINSV
RLFSLLANIGDAKSLVIHPASTTHSQLSEEEQRATGVTPEMIRLSVGIEDIRDILADLDA
GLRSAVISESPAAAQSATA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcggaataccacttcgataccctggcccttcacggcggctacgcgcccgaggcaaca
acgaaagcccgcgccctgcccatttaccagacgacctcgtaccagttcgacgatgccgac
catgctgcgcggctgttcgcactcaaggagtttggcaacatctacacgcggttgatgaac
cccacgaccgacgtgttcgagaagcgcctggccgcgctcgaaggtggagtggctgcgctg
gcgacagcttccgggcaggcagccgaaacgctggccatcaccacgatcgccagcgccggt
gacaacatcgtttcgaccaactcactctacggcgggacgtacaacctgtttcgctacacc
ctgcccaagctgggcatcaccgtgaagtttgtggatgccgacgactttgccggcatcgag
cagctcatagacgaacgcaccaaggccatctactcggagaccctgggcaacccgaacctg
cttgtgaccgacatcgaacgccttgcagagattgcccatcgccatggactgccgctcatc
attgacaacaccgcggcttcaccggcgctgtgccgtcccatcgagcacggcgcaaacatt
gtcatcgagagcgccacgaaattcatcggcggtcacggaacgagcatcggcggggtcatc
attgacggaggcaacttcgactggaaggcttccgggcgttttcccgatttcacgacgccc
gatccgtcctaccatggcatcgtttatacggaagcctttggccatctggccttcatcatc
aaggcgcgggtgcagggcctgcgggataccggcgcggcgctgtcgcccttcaacgccttc
ctgctggcgcaagggacggaaacgctctccctgcgcatggcgcgtcattcggaaaacgcc
ctcgctgtcgccaacttcctcaaaaaccatccccacgtcgcttgggtcaactatccgggt
ctggcggaaggcgaacagaaggcgcgggtagagaagtatctgcccaagggggccggggcg
ctcgtgaccttcgggattcagggcggttacgaggccggcaagcgcttcatcaattcggtc
aggctgttcagcctgctggccaacatcggcgatgccaagtccctggtcattcatccggct
tcaaccacgcattcccagctttccgaagaagaacagcgggcgacaggtgtgacgccggag
atgatccggctctccgtcgggattgaggacatccgcgacatcctggccgaccttgacgcc
gggttgcgcagcgccgtcatttcggaatcgccagcggcggcgcaatcggccacggcctga

DBGET integrated database retrieval system