KEGG   Chloracidobacterium thermophilum: Cabther_B0127Help
Entry
Cabther_B0127     CDS       T01629                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00010  Glycolysis / Gluconeogenesis
ctm00030  Pentose phosphate pathway
ctm00051  Fructose and mannose metabolism
ctm00052  Galactose metabolism
ctm00680  Methane metabolism
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01120  Microbial metabolism in diverse environments
ctm01130  Biosynthesis of antibiotics
ctm01200  Carbon metabolism
ctm01230  Biosynthesis of amino acids
ctm03018  RNA degradation
Module
ctm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_B0127
   00030 Pentose phosphate pathway
    Cabther_B0127
   00051 Fructose and mannose metabolism
    Cabther_B0127
   00052 Galactose metabolism
    Cabther_B0127
  Energy metabolism
   00680 Methane metabolism
    Cabther_B0127
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cabther_B0127
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cabther_B0127
Protein phosphatases and associated proteins [BR:ctm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cabther_B0127
Messenger RNA biogenesis [BR:ctm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cabther_B0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEP13132
UniProt: G2LJW5
Position
2:152098..153444
Genome map
AA seq 448 aa AA seqDB search
MTLPKPEDLIIHSLGECRFPSPLQLGAASGEYHGEFMSDAAKVRFHVELERLEGRPDDLF
FERAGPRERLFFDPSKVKAAIVTCGGLCPGINNVIRSVFLSLKYNYGVPEVYGIRYGYRG
LNPAYGDGFIRLTHEMVENIHLHGGTFLGSSRGPQPVEVMLDTLADRGIDMLFCVGGDGT
QRGADALAQAARRRNLPLAVVGIPKTIDNDIPYVFRSFGYGTAVEKAREVIAGAHAEAKG
APNGIVIVKLMGRNAGFIAAGATTASQEVNFAFIPELPFDLDPPNGFLAHLEKRVLQRGH
AVIVVAEGAGQHLFGDLPVERDASGNIKHHDIGTYLRDRIIAHFRERRIEANVKYIDPSY
LIRSVPANCDDAQLSDRFARYAVHAAMAGKTDLLIGYWHGLFVHVPMHLVTSQKKHLSPK
SSMWLSVLAATGQPVLMVNEPVPETTAS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgcccaaacccgaagacctcatcatccactcgctgggggagtgtcggtttccg
tcgccgctccagcttggcgcggcttccggtgaataccacggggagtttatgtccgacgcc
gccaaagtccgcttccacgtcgaactggaacgtctggaagggcgtcccgatgacctgttc
ttcgagcgggccggcccacgggagcggcttttttttgatccctccaaggtcaaagccgcc
attgtcacctgcggcgggctgtgtccgggcatcaacaacgtcatccggtcggtttttctg
tccctcaagtacaactacggcgtcccggaagtctatggcatccgctatggctaccggggc
ctcaatccggcctatggcgacggattcatccgcctgacgcacgagatggtggaaaacatc
cacctgcacgggggcacatttctggggtcatcccgtgggccgcagccggtggaagtcatg
ctcgacaccctggccgaccgtggcattgacatgctgttttgtgtcggcggcgatggaacg
cagcgcggcgctgacgctctggcccaggcggcccgccgacgcaacctgccgctggccgtg
gtcgggattcccaaaaccattgacaacgacatcccctacgtctttcgctccttcggctac
ggtacggccgtcgaaaaggcgcgcgaagtcattgccggggcgcatgccgaagccaagggc
gcgcccaatggcatcgtcatcgtcaagctgatgggccgcaatgccggttttatcgcggcc
ggcgcgacgacggccagccaggaagtcaacttcgccttcatccccgaactgccctttgat
ctcgacccgcccaacggctttctggcgcacctggaaaagcgggtcctccagcgtgggcac
gccgtcatcgtcgtggccgaaggagccgggcaacacctgtttggcgatctgccggttgaa
cgcgatgcctccggcaacatcaaacaccacgacatcgggacgtacctgcgcgatcgcatc
attgcccacttccgcgagcgtcgcatcgaggcgaatgtcaaatacatcgatccgagctat
ctcattcggagcgtcccggccaactgtgacgacgcccagttgagcgaccgctttgcgcgg
tacgccgtgcatgccgccatggccggaaagacggatttgctcatcggatactggcatggg
ctgttcgtccacgtgccgatgcacctggtgaccagccagaagaaacacctctcgcccaaa
agcagtatgtggctttcggtgctggcggcaaccgggcagccggtgctcatggtcaacgaa
ccagtcccggaaacaacggcgtcatga

DBGET integrated database retrieval system