KEGG   Chloracidobacterium thermophilum: Cabther_B0570Help
Entry
Cabther_B0570     CDS       T01629                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00071  Fatty acid degradation
ctm00280  Valine, leucine and isoleucine degradation
ctm00281  Geraniol degradation
ctm00310  Lysine degradation
ctm00362  Benzoate degradation
ctm00380  Tryptophan metabolism
ctm00410  beta-Alanine metabolism
ctm00640  Propanoate metabolism
ctm00650  Butanoate metabolism
ctm00903  Limonene and pinene degradation
ctm00930  Caprolactam degradation
ctm01040  Biosynthesis of unsaturated fatty acids
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01120  Microbial metabolism in diverse environments
ctm01130  Biosynthesis of antibiotics
ctm01200  Carbon metabolism
ctm01212  Fatty acid metabolism
Module
ctm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cabther_B0570
   00650 Butanoate metabolism
    Cabther_B0570
  Lipid metabolism
   00071 Fatty acid degradation
    Cabther_B0570
   01040 Biosynthesis of unsaturated fatty acids
    Cabther_B0570
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cabther_B0570
   00310 Lysine degradation
    Cabther_B0570
   00380 Tryptophan metabolism
    Cabther_B0570
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cabther_B0570
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cabther_B0570
   00281 Geraniol degradation
    Cabther_B0570
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cabther_B0570
   00930 Caprolactam degradation
    Cabther_B0570
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Cabther_B0570
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cabther_B0570
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Cabther_B0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C AlaDh_PNT_C Sacchrp_dh_NADP DAO NAD_binding_8 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEP13568
UniProt: G2LK81
Position
2:674395..676527
Genome map
AA seq 710 aa AA seqDB search
MVFRYEKDTDNIVTITMDMPQRSANVINAEFNAALAETFARLKAETELTGVIITSAKKTF
LAGADLEPMLEVRDPAALFQEIQQVKRIFRGMETFGKPFVAAINGAAMGGGLELALACHY
RILIDRPDAQVGLPEVTLGLIPGGGGITRLTRLLGLETALPLLTEGKRLSPAEARALGIV
NELAATPEELIAKAKAWIQANPEPRQPWDTKGYRLPGGDVRTPKVAQMITAAPAVLLKKT
RGNFPAPLAILSAAVEGTLVDFDTADRIESRYLANVATGQVAKNMIAAFWFQLNKINGGG
SRPADIPPATFSKVGILGAGMMGSGIAYACATAGLEVVLKDVTLEQAEKGKSYTEKVLRP
RVEKGRMKEADLAAILARIHPTTRAEDLRGCELIIEAVFEDRAVKKEATQEAEAQLAPTA
IFASNTSTLPITSLAQVSERPENFIGLHFFSPVDKMPLVEIIVGEKTSPETLARSFDFVR
QIKKTPIVVNDRRGFYTSRVFATYTSEGMTLLLEGQPASVIEAAGMQAGMPVGPLAVSDE
VSLKLMHYVRQQTERDLAAEGKPIPEQPSNRVLDAMLSQGRAGKAAGAGFYEYPPEGKKF
LWPGLRELFPPQAPLPFADIRDRLLFIQALETVRCLEENVVRSVADANIGSLFGWGFPAY
TGGTLQFINGYGVRAFVERAQALAARYGERFTPPARLLAMAEAGESFPMQ
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttcggtacgaaaaggacacggataacattgttaccatcacaatggacatgccg
cagcggtcggccaacgtcatcaacgccgagttcaacgcagcgctggcggaaaccttcgcc
cggctcaaggccgaaaccgagctgacgggtgtcatcatcacctcggccaaaaagacgttc
ctggccggtgccgacctggagccgatgctggaagtgcgtgatccggcggcattgtttcag
gaaattcagcaggtcaagcgcatttttcgcggcatggaaacgtttggaaaaccctttgtc
gcggctatcaatggtgcggcgatgggcggcggtctggagctggcgctggcgtgccactac
cgcattctcattgaccgcccggacgcgcaggtgggtttgccggaagtgaccctgggactc
atccccggcggcggcggcatcacgcgcctgacgcgcctgctggggcttgaaacggcgctc
ccgctgttgaccgaaggcaaacggctctctccggcggaagccagggcgctgggcatcgtc
aacgaactggcggcaacccccgaagaactcattgccaaggccaaagcctggattcaggcc
aatccagaaccacgccaaccgtgggatacgaagggctaccggctgcccggcggcgatgtg
cggacgcccaaagtagcgcagatgatcacggccgctccggccgtgctgctcaagaaaacc
cgtgggaacttcccggccccgctggccattctgagcgccgccgtggaagggacgctggtg
gatttcgacacggccgaccgcattgaatcgcgctacctggcgaacgtggctacagggcag
gtcgccaaaaacatgatcgcggccttctggtttcagctcaacaagatcaatggcggcggc
agtcgtccggctgacattccaccggcaaccttttccaaagtcggcatcctgggtgccggg
atgatgggcagcggcattgcctacgcctgcgcgacggccgggctggaggtcgttctcaag
gatgtcacgctggagcaggccgaaaagggcaaatcctacacggaaaaggtcctccgccca
cgggttgagaaagggcggatgaaggaagccgacctggcggcgatactggcgcgcatccac
ccgacgaccagggccgaagacctgcgcggctgtgaactcatcatcgaggccgtctttgaa
gaccgggccgtcaagaaggaagccacccaggaagccgaagcgcaactggcgccaacggcc
atttttgcctcaaacacgtccaccctgccgattaccagtctggctcaggtgtccgagcgg
ccggaaaacttcatcgggctgcacttcttttcgcccgtggacaaaatgccgctggttgaa
atcatcgtcggcgaaaagacttcgccggaaaccctggcgcgcagctttgatttcgtccgg
cagatcaaaaagacgcccatcgtggtcaacgaccggcgtgggttttacacctcgcgggtg
tttgccacctacacctcggaaggaatgacgctgttgcttgaaggccagccggccagcgtc
atcgaggccgccgggatgcaggccgggatgccggttggcccgctggccgtttcggacgaa
gtgagcctgaagctgatgcactacgtgcgccagcagacggaacgcgatctggcagcggaa
ggcaaacccatcccggagcagccgtcgaatcgcgtcctcgacgccatgctgtcccagggg
cgcgctggcaaggcggccggagccggtttctacgaatatccgcccgaaggcaaaaagttc
ctctggccgggtctgcgggaactgtttccgccccaggcacctctgcccttcgcggatatt
cgtgaccggttgctgttcattcaggcgcttgaaaccgttcgctgcctcgaagaaaacgtg
gtgcgttcggtggcggatgccaacatcggcagcctgtttggctggggtttcccggcctac
accggcgggacgttgcagttcatcaacggctacggcgttcgggcttttgtcgaacgcgcc
caggccctggccgccaggtacggagaacggttcaccccgccggcgcgcctgctcgccatg
gcggaagcgggcgagtcgttccccatgcagtga

DBGET integrated database retrieval system