KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0616Help
Entry
Cabther_B0616     CDS       T01629                                 

Definition
hopanoid-associated sugar epimerase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Brite
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Cabther_B0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(735699..736685)
Genome map
AA seq 328 aa AA seqDB search
MKVFVTGGTGFVGASVLRELLAGGAEVRALARRNSDRRNLEGLNIEVVEGDLDDVALLTR
AMADCEWAFHVAAHYSLLRRDRDAIYRANVEGTRHVLQAARAAGIKRLVHTSSVAAIGVP
PEGEVADETFQTTVGELVSDYKKSKFLAEQLARDAAREGLPVVIVNPSTPIGPYDVKPTP
TGDIVLRFLQRRMPAYVDTGMNLIHVRDVAIGHIRAAEKGRVGERYILGHRNMTLKEILD
TLAAITGLPAPTRRLPHWLPVVVGAVDEFFLSRLTGKPPTVAFDSARMAAHPMYYDATRA
VTYLGLPQTPIETALQEAVTWFRDHGYV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttgtcacaggcggcaccggctttgtcggtgccagtgtgctgcgcgaactg
ctcgccggtggggctgaagtccgggcgctggcgcgacgcaacagtgaccggcgcaatctc
gaaggtctgaacatcgaagttgtcgaaggcgatctcgacgatgtggcgctgctgacccgc
gccatggccgactgtgagtgggcctttcacgtggccgcccactacagcctgctgcggcgt
gaccgggacgccatctatcgcgccaatgtcgaaggcacgcgccacgtcctgcaggcagcg
cgcgccgccggcatcaaacgccttgtccacaccagttcggtggcggccatcggcgtaccg
cccgaaggcgaagttgccgacgagacgtttcagaccaccgtcggggaacttgtcagcgat
tacaagaagtccaagtttctggcggaacagcttgcccgcgacgccgcccgcgaggggctt
cccgtcgtcatcgtcaatcccagcacgcctattgggccgtacgatgtcaaacccacgccg
accggcgacatcgtgttgcgcttcctgcaacggcgcatgccggcctacgtggacacgggg
atgaacctgattcacgtgcgggatgtcgccatcgggcatatccgtgccgccgagaagggg
cgcgtcggcgagcggtacatcctcggccaccggaacatgacgctcaaggaaattctggac
accctggcggccatcaccgggctgccggccccaacgcgccgcctgccccactggttgcct
gttgtcgttggcgcagtggatgaattcttcctgagtcggctgacgggaaagccgccgacg
gtcgcctttgattcagcccgcatggcagcgcatccgatgtattatgacgcaacgcgcgcc
gtgacctacctgggcctgccccagacgcccatcgagacggcgttgcaggaagctgtaacc
tggtttcgggaccatggctacgtctga

DBGET integrated database retrieval system