KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_B0690Help
Entry
Cabther_B0690     CDS       T01629                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cabther_B0690
Enzymes [BR:ctm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cabther_B0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(836508..838061)
Genome map
AA seq 517 aa AA seqDB search
MTTYRWPRACGLLLHPTSLPGPDGIGTLDGHLEQWLDFLAAAGQTYWQILPLVPTGYGDS
PYAGLSAFAGNPLLIPSETLVELGLVPRQRLHERPPFSEQRVDYGAVITWKQRLLAEAFE
RFAAAAPDAWRADFEAFCAAEADWLTDYALFRALKDAHGGRAWHTWPPELRDRKPAALEA
ARRNLSTAVASHQFQQWLFFRQWQRTREACHRRGIRIIGDAPIFVAYDSADVWANRELFK
LDAEGRPTHVAGVPPDYFSATGQLWGNPLYRWQRMADTGFGWWLARMRHLFRLVDVVRLD
HFRGFAACWTIPADAPTAATGRWVKTPGRKLFTAMRRAFGVLPIIAEDLGVITPDVVALR
DAFGFPGMRVLQFAFGGDPNNQDLPHNYVPNAVVYTGTHDNDTTVGWYASRPGVGSTRDA
EGIERERAFCRAYLNTNGAEIHWDFIRAAYASVAHTAIVPMQDVLGLGSEGRMNLPASER
GNWSWRCRREDFTASAAKRLRELAYLYGRLPGSSGSD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacctaccggtggccgcgcgcctgcggcctgttgttgcaccccacctcgttgccc
gggccggatggcattggcacgctggacgggcatctcgaacaatggctcgattttcttgct
gctgcgggccaaacctactggcaaatcctgccgctggtgcccaccggctacggcgactcg
ccttacgccggcctgtcggcctttgccggaaacccactgctgattccatcggaaaccctg
gttgaactgggtctcgtgccgcgccaacggctgcacgaacgtccgcctttctccgaacaa
cgtgtggattacggcgcggtcatcacctggaagcagaggcttctggcggaagcctttgag
cgtttcgcggcggccgccccggatgcctggcgagccgatttcgaggcgttttgcgcggct
gaagccgactggctgaccgattatgcgctcttccgggcgctcaaagatgcccacggcggc
cgcgcgtggcatacgtggccgccagagttgcgcgaccggaagccagcggcgctggaagcc
gcccggcgcaacctgagtacggccgtggcctcgcaccagtttcagcagtggcttttcttc
cgccagtggcagcgcacccgtgaagcctgtcaccgccgtggcatccgcatcatcggcgac
gcgccaatttttgtcgcctacgactcggccgatgtctgggccaaccgggaactgttcaag
ctcgatgccgaggggcggcccacgcatgttgccggcgtaccgccggactacttcagtgcc
acgggacagctctggggcaatcccctctaccgatggcagcgcatggcggacactggtttt
ggctggtggctggcccggatgcgccatctgttccggctcgtggatgtcgtgcggctggat
cacttccgtggttttgctgcctgctggaccattccggccgacgcgccgacggcggctacc
ggcaggtgggtcaaaacacccggacgcaagctgtttacggcaatgagacgtgcgtttggc
gtcctgcccatcattgccgaagacctgggtgtgattaccccggatgtcgtggcgctgcgc
gatgccttcggttttcccggcatgcgggtgttgcagtttgcctttggcggcgatcccaac
aatcaggacctgccgcataactacgttcccaatgccgtggtttataccggaacgcacgac
aacgacacgacggttggctggtatgccagtcgtccgggcgtcggttcgacgcgcgacgcc
gaagggattgagcgggaacgggctttctgtcgggcgtatctcaacaccaatggcgctgag
attcactgggatttcatccgggcggcttacgccagcgtggcccatacggcgattgttccg
atgcaggatgtcctggggctggggagtgaagggcgcatgaacctgccagccagtgaacgc
ggcaactggtcctggcgctgccggcgggaggacttcacggcatcagcggccaaacgcctg
cgcgaattggcctacctgtacggccggttgcccggttcatccggctcggattga

DBGET integrated database retrieval system