KEGG   Chloracidobacterium thermophilum: Cabther_B0777Help
Entry
Cabther_B0777     CDS       T01629                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase-like enzyme
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00521  Streptomycin biosynthesis
ctm00523  Polyketide sugar unit biosynthesis
ctm01130  Biosynthesis of antibiotics
Module
ctm_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cabther_B0777
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cabther_B0777
Enzymes [BR:ctm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cabther_B0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_2
Motif
Other DBs
NCBI-ProteinID: AEP13774
UniProt: G2LLH8
Position
2:938522..938971
Genome map
AA seq 149 aa AA seqDB search
MIDGVAVRPLRQIPDERGKIMHMLRADAPHFERFGEIYFSCVYPGAIKAWHIHKAMTLNY
AVIVGRIKLVLYDDREHSPTRGELMELFIGDGNYALVTIPPRIWNGFKGIGTETAIVANC
ATLPHDPEEIERMDPFTDRIPYRWDIRHG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgattgacggcgtggccgtgcgccccctgcggcagattcctgacgaacgcggcaagatc
atgcacatgctgcgggctgatgcgccgcacttcgagcggttcggcgagatttacttttcc
tgtgtctatccgggagccatcaaggcctggcacatccacaaggcaatgacgctcaactac
gccgtcatcgtcgggcgcatcaagctcgtgctctacgacgaccgggagcactcgccgacc
cgtggcgaactcatggagctgttcatcggggacggcaactacgccctcgtgaccatcccg
ccccggatttggaacggcttcaaaggcattggcacggaaacggccatcgtggccaactgt
gccaccctgccccatgacccggaggaaatcgaacggatggacccgttcaccgaccgcatt
ccctaccgctgggacatccgccacggatga

DBGET integrated database retrieval system