KEGG   Chlamydia trachomatis L2c: CTL2C_162Help
Entry
CTL2C_162         CDS       T01574                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cto  Chlamydia trachomatis L2c
Pathway
cto00230  Purine metabolism
cto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTL2C_162 (gmk)
Enzymes [BR:cto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTL2C_162 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin dNK Stealth_CR3 AAA_22 AAA_16 AAA_17 Zeta_toxin AAA_23 AAA_33 AAA_30 AAA RNA_helicase TsaE
Motif
Other DBs
NCBI-ProteinID: AEJ77083
Position
355970..356587
Genome map
AA seq 205 aa AA seqDB search
MSVKVISPFSQDGVQCFPKLFIISAPAGAGKTTLTHMLQREFPDAFEKTVSSTTRSARPG
EVHGVDYLFVSEDDFKQSLDREDFLEWVFLFGTYYGTSKAEISRVLQKGKHCIAVIDVQG
ALALKKQMPAVTIFIQAPSQEELERRLNARDSEKDFQKKERLEHSAVEIAAASEFDYVVV
NDDLITAYQVLRSIFIAEEHRMSHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaggttatttcccccttttctcaagacggggttcaatgctttcccaagctt
tttatcattagcgctcctgctggagcagggaagacaacactcacccatatgctacaaaga
gagtttcctgatgcatttgagaagacggtgtcgtcaacgacacgttcggctcgtccaggc
gaagtgcatggcgtggattatttgtttgtatctgaagatgactttaagcaatctttagat
agggaagattttttggaatgggtctttttatttgggacttattacggaacgagtaaggcg
gagatttctagagttctgcaaaagggtaagcactgcatagccgtgattgatgtacaagga
gctttggctctgaagaagcaaatgccggcagtcactatttttattcaagctccctctcaa
gaagaacttgagcgccgtttgaatgctcgggattcagagaaagatttccagaagaaagaa
agattagagcatagcgctgtcgaaattgctgccgctagcgaatttgattatgttgtggtt
aatgatgatttgattacagcatatcaagttttaagaagtatttttatagctgaagaacat
aggatgagtcatggctag

DBGET integrated database retrieval system