KEGG   Chlamydia trachomatis L2c: CTL2C_239Help
Entry
CTL2C_239         CDS       T01574                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cto  Chlamydia trachomatis L2c
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cto03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585275..585877
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYISKLISFLKKLPGIGFKSAEKIAFELLEWDPSQIEAMALALQEFSTSHATCSN
CFCLKISQTSPCNFCSESRDSSSLCIVATPKDVFALEKSKIFKGHYFVLGNLLSPITGKH
LSLEKLAILKQRIEACSPKEMIIALDATLEGDATALFLKQEFSYLPIKISRLALGMPVGL
SFDFVDANTLARAFSGRNCF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatatcctgattacatttcgaaactcatttcatttttaaaaaagcttccagga
attggctttaaatcagcagaaaaaatagcttttgaattattagaatgggatccatctcaa
attgaggctatggctctagcattacaagagttctctacttcgcatgcaacttgctcaaac
tgtttttgtttaaaaatctctcaaacttccccttgtaacttttgcagtgaatctcgagat
tcttcttccttatgtatcgttgcaactcctaaggatgttttcgctctggagaaatctaag
atcttcaaagggcactatttcgttttaggaaacttactttctcccatcactggaaagcat
ttgtctttggaaaaattagctattcttaagcagcgaattgaagcttgttcccctaaagaa
atgatcatagctcttgacgcaactttggaaggagatgcaactgcattgtttttgaaacaa
gaattttcttaccttccaataaaaatctctagattagctcttggaatgcctgtcggtctc
tcctttgattttgttgatgctaatactttagctcgagctttttcaggaagaaattgcttt
taa

DBGET integrated database retrieval system