KEGG   Chlamydia trachomatis L2c: CTL2C_258Help
Entry
CTL2C_258         CDS       T01574                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cto01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cto01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cto00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cto00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cto00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:cto00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548228..549889
Genome map
AA seq 553 aa AA seqDB search
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETFPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPDSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICEIIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaataaacatgcttctctttgtcaaaagacgccttctttgtgtcgggagctt
caaaaagctcctgctcttctattaacagaagacataaggtttaaagctcttcttaatgaa
cgcattgactctgttgcagaactatttccatgcacttataactctccctactacaaattt
atttcgaagtccgatctttccgctgagacctttccccttaaagtgggcgttatgctttct
ggaggcccagctcctggtgggcacaatgtcatcttaggattgctacacagtattaaaaag
ctccatccggatagtcagcttttaggatttattcgcaatggagaaggacttctcaataat
aatactgtagaaatcacagatgaattcattgaagagtttcgtaactctggaggctttaat
tgcataggaacaggtcgcactaatatcataaccgaagaaaacaaagcgcgctgtttacaa
acagcaaatgaactcgatttagatggattagtgattattggaggcgatggttcgaataca
gccacggcgattcttgctgaatattttgctaagcatcaagcaaaaacggtattagttggt
gttcctaaaactattgatggagatttgcagcacctatttttagacctcacatttgggttt
gatactgctactaaattttattcatccatcatcagcaacatttctagagacgcattatcg
tgtaaaggccactatcattttattaaactaatgggccggtcttcttctcatatcacgcta
gaatgcgcactacagactcacccaaatattgctcttataggcgaagagattgcagaaaaa
agcatctccttagaaacattaatccatgatatttgtgaaataatagcagatcgagctgct
atggggaaataccatggcgttattctcatccctgaaggagtcattgagtttattcctgaa
atacagtctctggttaaagaaattgaatccattccagagcaggagaatctttaccaagct
ttatccttatcttctcagcaacttttatgccaatttccggaagatatttgccatcagctc
ttgtataatagagatgctcatggcaacgtctatgtatcaaaaattagtgttgataaactt
ctgattcatctagttcgtcaacatttagaaacacattttagacaagttcccttcaatgca
atctcccattttttaggttatgaagggcgttcaggaactcctacacattttgataatgtg
tatagctataacttaggatatggtgctggggttctcgtttttaaccgctgtaatgggtat
ttatccacgatcgaaggtctaactagccctattgaaaaatggcgattgcgcgctttaccc
attgttcgaatgttgacgaccaagcaggggaaagacagtaaacattatcctctgataaaa
aaaagattggtagatattgctagtcctgtttttaataagttctcactgtatcggaaaatc
tgggctttagaagactcctatcgctttgtagggccattacaaatacattctccggaggat
gctcattctgatgattttcctcctttaattttgtttttgaatcataatgaatggcaaaaa
cgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system