KEGG   Chlamydia trachomatis L2c: CTL2C_29Help
Entry
CTL2C_29          CDS       T01574                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTL2C_29 (tpiA)
   01230 Biosynthesis of amino acids
    CTL2C_29 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTL2C_29 (tpiA)
   00051 Fructose and mannose metabolism
    CTL2C_29 (tpiA)
   00562 Inositol phosphate metabolism
    CTL2C_29 (tpiA)
Enzymes [BR:cto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTL2C_29 (tpiA)
Exosome [BR:cto04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTL2C_29 (tpiA)
  Exosomal proteins of bladder cancer cells
   CTL2C_29 (tpiA)
  Exosomal proteins of melanoma cells
   CTL2C_29 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
687716..688441
Genome map
AA seq 241 aa AA seqDB search
MNKTLTEAQTFLKSFLSSDILSNPQIITGIIPPFTLLSACQQAVSDSPIFLGAQTTHEAD
SGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGET
LEEQESGATQDILLNQLTIGLSKLPEQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRK
TIASLFSKDIAERTPILYGGSVKADNARSLSLCPDVNGLLVGGASLSSENFLSIIQQIDI
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgcttaccgaagctcagacctttttaaaaagtttcctctctagtgacatt
ctgtctaatccccaaatcattacaggaatcattcctcctttcacactgctgtcagcttgt
caacaagctgtaagcgattcccccatctttcttggagcccaaaccactcatgaagctgac
tcaggagcttttactggtgagatttcagccccaatgctcaaagatatcggagtcgatttt
gttctcatcggacattccgaaagacgtcatatctttcatgaacaaaatcctgtacttgct
gaaaaagctgctgcagctatccatagtggaatgattccagttctgtgtattggagaaact
ctagaagaacaagaatctggagcaactcaagatattcttttaaatcaactgactatagga
ttatctaaactccctgagcaagcctctttcattctagcttatgaaccagtctgggctata
ggcaccggaaaagtagctcatcctgatctagttcaggaaacccatgctttctgtagaaaa
acgattgcttctctcttttccaaagatattgcggaacgcacccccattctttacggagga
tctgtgaaagccgataatgctcgctcactttccctctgccctgatgtgaatggtctttta
gttggaggagcctctttatcttcagagaatttcttatccattatacaacaaatcgatatc
ccataa

DBGET integrated database retrieval system