KEGG   Chlamydia trachomatis L2c: CTL2C_29Help
Entry
CTL2C_29          CDS       T01574                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cto01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cto01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cto00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cto00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687716..688441
Genome map
AA seq 241 aa AA seqDB search
MNKTLTEAQTFLKSFLSSDILSNPQIITGIIPPFTLLSACQQAVSDSPIFLGAQTTHEAD
SGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGET
LEEQESGATQDILLNQLTIGLSKLPEQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRK
TIASLFSKDIAERTPILYGGSVKADNARSLSLCPDVNGLLVGGASLSSENFLSIIQQIDI
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgcttaccgaagctcagacctttttaaaaagtttcctctctagtgacatt
ctgtctaatccccaaatcattacaggaatcattcctcctttcacactgctgtcagcttgt
caacaagctgtaagcgattcccccatctttcttggagcccaaaccactcatgaagctgac
tcaggagcttttactggtgagatttcagccccaatgctcaaagatatcggagtcgatttt
gttctcatcggacattccgaaagacgtcatatctttcatgaacaaaatcctgtacttgct
gaaaaagctgctgcagctatccatagtggaatgattccagttctgtgtattggagaaact
ctagaagaacaagaatctggagcaactcaagatattcttttaaatcaactgactatagga
ttatctaaactccctgagcaagcctctttcattctagcttatgaaccagtctgggctata
ggcaccggaaaagtagctcatcctgatctagttcaggaaacccatgctttctgtagaaaa
acgattgcttctctcttttccaaagatattgcggaacgcacccccattctttacggagga
tctgtgaaagccgataatgctcgctcactttccctctgccctgatgtgaatggtctttta
gttggaggagcctctttatcttcagagaatttcttatccattatacaacaaatcgatatc
ccataa

DBGET integrated database retrieval system