KEGG   Chlamydia trachomatis L2c: CTL2C_448Help
Entry
CTL2C_448         CDS       T01574                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cto00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTL2C_448 (recD)
Enzymes [BR:cto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTL2C_448 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28246..29736
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVPSLLAQHILLPFDIAFAQKHLSQEEFSQEAEAFLATASALLRCGYPYFS
ICDETIHPTLPGISNKQLFQWFQLLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIALLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIMVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGRSPVDLLLVDEGSM
VTMNLLHGLIKTIRGESRGETIYADRMVIFGDANQLSPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPRAPIPIIVTERYETWGLTNGDTGVLDPVTEQLRFMNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtaccatctttgttagcacaacatattctt
ctcccttttgatatagcttttgctcaaaagcatttatcccaggaagagtttagtcaggaa
gcagaagctttcttagctacagcatccgcattattgcgttgtggttatccttatttttct
atttgtgatgagacgattcatcccacgctcccagggatttcaaataaacaactcttccaa
tggttccagctgttgtcatcccgcataaaagaagaactgtttgaagttgttaatcataaa
atttatctacgctcattatttcttttacgggagaaggtgtttcataaattgcatagattg
gcgggagccgttccacgtacacctttaatttttgaagagattgctctgctctcagaagag
cagaaccaggtactgaaaactgtattaaattcttgcttctctctcgtttgtggaggacca
ggaacaggcaaaacatttttagctgttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagatcatggtagcttctccaacggggaaagcttccgctcatctgcatagcgta
ttaacgtctcagggaatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagagggcgctcccctgtagatctactattggttgatgaaggctcgatg
gtgaccatgaatctgttacatggactgattaaaaccatacgaggagaatcccgaggggaa
acgatctacgcagatagaatggtgatttttggggatgcgaatcagctttctccaataggt
attggagtgggaaatccttttcatgaagtagtgtctgagttttctaaacaggcatgcttt
ttatctaccagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttggggttttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccacgggcacctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggagatacaggagttttagatcctgtaacggaacaattgcgtttcatgaatggg
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgttattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system