KEGG   Chlamydia trachomatis L2c: CTL2C_570Help
Entry
CTL2C_570         CDS       T01574                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cto  Chlamydia trachomatis L2c
Pathway
cto00010  Glycolysis / Gluconeogenesis
cto00020  Citrate cycle (TCA cycle)
cto00620  Pyruvate metabolism
cto01100  Metabolic pathways
cto01110  Biosynthesis of secondary metabolites
cto01120  Microbial metabolism in diverse environments
cto01130  Biosynthesis of antibiotics
cto01200  Carbon metabolism
Module
cto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTL2C_570
   00020 Citrate cycle (TCA cycle)
    CTL2C_570
   00620 Pyruvate metabolism
    CTL2C_570
Enzymes [BR:cto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTL2C_570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 Transferase
Motif
Other DBs
NCBI-ProteinID: AEJ77489
Position
593730..595019
Genome map
AA seq 429 aa AA seqDB search
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP
SITMMGFRPEPPLATPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIIKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGSTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtttctttgttaaaaatgcctaagctctcccctacaatggaaatagggattcttgtt
aaatggcacaaaaaagctggggatgaaattcatttcggggatgtattactagaaatctct
actgataaagctgttttagaacatacagcttctgaagatggttggttattagaaattctt
gttaaagaaggaaccaaaactcctattggcactcctatcgctgtattttcaacagaacaa
aatgctcaatatgatttaaaacagctcctacctttggaagaaactgttgttacagatgca
gctacagaagcatcgccaaaagactctgctcaaacagattctcaatacacaagtggccct
tccataactatgatgggattccgtccggaaccacctttagctactcctctaactattaaa
cattccaacgatccagtattagcttctcctttagcaaaaaaattggccaaagagcaaaat
ctagacctctctggagtaactggtagtggacctggaggacggatcataaagaaagatttg
gaaaaagctcctcctttaagaattgctgggtttggttaccctgaagctccaaatgttaat
ccgggatcttatatagaagaacctctttcccctgttcgagaagtcatatctaaacgtctg
caagctgctaaaacctttattcctcacttttatgtaaggcagcgcatttacgcttccccc
cttcttgcattattaaaagaacttcaagaacaaaatattaagctctctatcaatgattgt
attgtacgagcctgtgctttagctctgaaagaattcccagaaattaattctggattcaat
agtgtcgacaataagattattcggttttctacgattgatatctctattgctgtagctatt
cctgatggagttatcactcctattgtccgctgtgctgatagaaaaaatattggtatgatc
tctgcagaaatcaaaggacttgcaactaaagccaaacagcagtctcttgcagaagaagaa
tacaaaggaggttctttctgtgtatctaatcttggtatgacagggatctctgatttcact
gctattttgaatcctccacaagctgctattctagctgtaggaagcgtagaggaacaacct
gtagtcttaaatggagagctagctgtaggctcgacctgtatgttgacattgtcggtagac
cacagagtgattgatggatatcctgcagccatgttcatgaaacgactgcagagactcctc
gaagctccttctgttttacttctcaattaa

DBGET integrated database retrieval system