KEGG   Chlamydia trachomatis L2c: CTL2C_731Help
Entry
CTL2C_731         CDS       T01574                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTL2C_731 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTL2C_731 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTL2C_731 (trpB)
Enzymes [BR:cto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTL2C_731 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
511749..512927
Genome map
AA seq 392 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATAC
AYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSF
THYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHH
FIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAP
SLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgctcgagctattgatggccctagagtatttcttaaacgcgaagatcttttgcataca
ggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatatcttgggaaa
acacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagcaacagcgtgt
gcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaacgacagaaa
ccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaacaaaaggatct
tgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaacacactcattt
actcactattgcttaggatcggccttaggacctttaccttatcccgatatcgttcgattt
tttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgcaggaagagat
cctgatattctgattgcatgtatcggaggtggctccaacgctattggatttttccatcat
tttatcccgaatccaaaagtccaattaattggagtggaagggggaggactgggcatttct
tcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccacggattttat
tcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatttccgctgga
ttagattatccttcagttgggccagatcatgccgaaatgcatgagtcaggacgagccttt
tatacattagccaccgatgaagaggcgttacgagcttttttcctgcttactagaaatgag
gggattattcctgcattggagtcttcacatgctctcgcacatttagtttcgattgctcct
tctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaggtgataaggatctt
ccacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system