KEGG   Chlamydia trachomatis L2c: CTL2C_8Help
Entry
CTL2C_8           CDS       T01574                                 

Definition
dihydrofolate reductase type 1 from Tn4003 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cto  Chlamydia trachomatis L2c
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTL2C_8
   00670 One carbon pool by folate
    CTL2C_8
Enzymes [BR:cto01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CTL2C_8
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1009850..1010329)
Genome map
AA seq 159 aa AA seqDB search
MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR
DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKK
YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc
aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat
cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg
gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt
gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt
gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaagaaa
tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt
tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system