KEGG   Chlamydia trachomatis L2c: CTL2C_8Help
Entry
CTL2C_8           CDS       T01574                                 

Definition
dihydrofolate reductase type 1 from Tn4003 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cto  Chlamydia trachomatis L2c
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cto00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cto00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1009850..1010329)
Genome map
AA seq 159 aa AA seqDB search
MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR
DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKK
YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc
aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat
cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg
gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt
gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt
gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaagaaa
tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt
tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system