KEGG   Chlamydia trachomatis L2c: CTL2C_916Help
Entry
CTL2C_916         CDS       T01574                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cto  Chlamydia trachomatis L2c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTL2C_916 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTL2C_916 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTL2C_916 (trpA)
Enzymes [BR:cto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTL2C_916 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
512920..513681
Genome map
AA seq 253 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPYEAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtt
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccattttttgaagat
cttttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggaacgg
atgtctttaatacaagaatacgcaagaggctttctgtattatatcccatatgaagctacg
agagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatctt
ccaattgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattat
tcagatggtttcattgtgaaaacagcgtttgttcatcaaacaacaatggattcttcggta
gagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system