KEGG   Candida tropicalis: CTRG_00395Help
Entry
CTRG_00395        CDS       T01115                                 

Definition
similar to palmitoyl protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ctp  Candida tropicalis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CTRG_00395
  Lipid metabolism
   00062 Fatty acid elongation
    CTRG_00395
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CTRG_00395
Lipid biosynthesis proteins [BR:ctp01004]
 Fatty acid synthase
  Component type
   CTRG_00395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MLLSSIAGLQQVVINLISHNRLDLQSDSIYSYDQPDSPPIPNPFRPVVVWHGLGDDYNSS
GIHNLHSILDSLYPGIYLYSIRLADDPSSDQQKSFFGDANDQVDQVCEALHNITELQHGF
DAIGFSQGGVFFRGLIERCSVKVDNLITFGSPHFGVSELPLCKDPKDWLCKRRNALLKKQ
VWYDVVQRRVIPAQYFRDPSALDNYLKYSNYLADINNERDEKNSTYKENFASLNNLVLVS
FTEDTTVVPKESSKFFDFDPIAKISIPFDQTDLYKNDYIGLKTLHEKGAIDFLNIEAEHM
QIDEDFIRDIAGKYFGTRLV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatcatcaatagcaggtctacaacaagttgtaattaatttgatttcccataat
cgattggatttacaatctgattctatctattcttatgatcaaccagattcgccaccaatt
ccaaaccctttcagacctgtggttgtttggcatggtttaggagacgattacaattcatca
ggaatacataatttgcacagcattttggatagtctatacccagggatatatttatactca
atacgtttggctgatgatccgtcatctgatcaacaaaaatcgttttttggtgatgccaat
gatcaggttgatcaagtttgcgaagcgttgcataatatcacagaattacaacacgggttt
gatgcaattggtttttcacaaggtggagtgttttttagaggtttgattgaaagatgttct
gtcaaagttgataatctcattacatttggttctcctcatttcggagttctggaattacca
ctatgcaaggatccaaaagactggctctgtaagcgacgaaacgctcttctaaagaagcaa
gtatggtatgatgtagttcaaagacgggttattccagcacaatattttagggatccactg
gctctagataactacttgaagtattcaaattaccttgcagacatcaataatgaaagagac
gagaagaatagcacttataaggaaaattttgcaagtctcaataatttggtcttagtgagt
ttcacagaggataccacagttgtacctaaagaaagttccaagttttttgattttgatcct
attgcaaaaatcagcattccttttgatcaaactgatctttataaaaatgattacattggc
ttgaaaacacttcatgaaaaaggagctatagatttcttaaacatcgaagctgaacacatg
caaattgatgaagacttcatccgtgatattgctggtaaatattttggtactagattagta
tag

DBGET integrated database retrieval system