KEGG   Candida tropicalis: CTRG_00438Help
Entry
CTRG_00438        CDS       T01115                                 

Definition
similar to protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ctp  Candida tropicalis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CTRG_00438
Enzymes [BR:ctp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CTRG_00438
Glycosyltransferases [BR:ctp01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CTRG_00438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 766 aa AA seqDB search
MPDAYSSGISSHESGEDRSIYKRKEKEDLSRTRLTSPDDKDLGIDEIIDKTAKLNISSRR
FDSVHPLFIRVINPLILTAISSFIRLYRIERANYVVWDEAHFGQFGSHYLKREFYFDVHP
PLGKLLVALSGYLAGYDGNFKFDSGNPFPDDMNYVFMRVFNAFFGILVTPLAYRTAVLLG
YSQFTCWLVSLMVIFEQISLTLSKFILLDSMLLFFTVFTFFGLVNLHILSKKDQLMTKSG
IKWFLLTGVGIGCVCSVKWVGLFVTAVVGFYTIYDLLMKFYQTVSTTQMTWKTYTSHWII
RVFSLIIIPTAIYITAFKVHFAVLNHSGPGDGSISTLLQASLIGSDIGSGPRTVAFGSLV
TMRSQGLSPNLLHSHDHKYPGGSQEQQVTTYGFKDENNDFLIEFDVSEGLKDKHATLENE
NGVDYYSIPVPNGATIRINHKKTGCYLRANSITAPITSSNFEVSCSGEVESNDYADEWIL
EIQTQEQSPSEKFHSEDANVLHPISTNFRLKHKQLGCYLATTGKSYPSWGYGQGEVACKF
SFFSRDKNTWWNVEKHVNDKLPTPNEKYVPPKPKFWKEFVLLNYGMMAANGALIPDPDKF
DKLSSEWWEWPVLHTGLRMCGWGADDIKYFLLGNPLITWLSTAGVALFLVYTFVQGFRYQ
RQVTSNSLAEGGLLFLGWLFHYVPFIFMGRVKYLHHYLPAHYFAIFLFGFVVDKTISKNI
GVRWTIYSLFYIAILASFWYFKDLSFGMEGPSSNYKHLKLLGSWMI
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgcatattcatcaggaatttcatcacatgaaagtggtgaagacagatcaatt
tataaaagaaaggaaaaagaagatctttctcgtacaaggttaacatcgccggatgataaa
gatttgggaattgatgaaataattgacaaaactgctaaacttaatatcagttctagacgt
tttgattctgtgcatcctttatttatcagggttattaatccattgatattgacagcaatt
tcatcttttattcgtctttatagaattgagagagcaaactacgttgtttgggacgaagcc
cactttggtcaatttggatcccattaccttaaaagagagttttactttgatgtccaccct
ccattaggaaaactattggttgcactttctggatatttggcaggctacgatggaaatttt
aaatttgacagtggtaacccattcccagatgatatgaattatgtctttatgagagtattc
aacgcgttttttgggatacttgtgactccattggcatatagaactgccgtgctcttagga
tatagtcagtttacgtgttggcttgtgagtttaatggttatttttgaacaaatttcatta
acactatctaagtttatcttgttggactcgatgttgctattttttactgtgtttaccttc
tttggtttagtcaatttgcacattctctccaaaaaagatcaattgatgaccaaaagtgga
attaagtggtttttattgactggtgtaggtattgggtgtgtgtgttcagttaaatgggtg
ggtctctttgtcactgcggttgtagggttctacacgatttatgatttgttgatgaagttc
tatcaaactgtgtccacgactcaaatgacatggaaaacttatacctcccattggattata
agggtgttttccttgataataatcccaactgctatttatattacagctttcaaggtgcat
tttgcggttttaaaccattcaggtccaggtgatgggtcaatttcaaccttgttacaagcc
tccttaatcgggtctgacataggctctggtcctagaacggttgcatttggttctttggtg
acaatgagatctcaaggattgtcacccaatctccttcattctcatgaccacaaataccct
ggtggatcacaagagcaacaagtaactacgtacggtttcaaggatgaaaacaatgatttt
ttaattgaatttgatgtttcagaaggcttgaaagataagcatgcaaccttggaaaatgaa
aatggcgtagattactacctgattccagtaccaaacggtgctacaattagaataaatcac
aagaaaactggatgttatttgcgtgcaaattcaatcacagcaccaataacctcaagcaac
tttgaagtttcttgctccggagaagttgaatcaaatgactatgctgatgaatggatactt
gaaattcaaactcaggaacaatcaccatctgaaaagttccattccgaagacgcaaatgtg
cttcatccaatatcaaccaattttagattgaagcataaacaattgggctgttacttggca
accacaggaaaatcgtacccttcttggggatacggtcaaggagaggtagcctgtaagttc
tcattcttcagtcgtgataagaacacttggtggaatgtggagaagcacgtaaatgataaa
ttgccgactcccaatgaaaaatatgttcctcctaagccaaaattctggaaggaatttgtt
ttgttaaattacgggatgatggctgcaaacggggcattaataccagatccagacaagttt
gacaagttgagctcggaatggtgggaatggccagttttgcatactggtcttagaatgtgt
ggttggggagccgatgatatcaagtacttcttacttgggaacccattaataacctggttg
tccacagcaggagtggctttattcctagtttacacatttgtacagggtttccgttaccag
agacaggttacttcgaattcacttgcggaaggtggattattgtttctcggttggttgttc
cattatgtgccattcatcttcatgggtagggtaaaatatcttcaccattacctccctgcc
cattactttgctatttttctttttggttttgtcgttgacaagactataagcaagaacatt
ggtgttagatggactatttattctttgttttatatcgctattcttgcttccttttggtat
ttcaaggatttgtcgttcggaatggaaggtccttcactgaattacaaacacttgaaacta
cttggttcttggatgatctag

DBGET integrated database retrieval system