KEGG   Candida tropicalis: CTRG_00472Help
Entry
CTRG_00472        CDS       T01115                                 

Definition
similar to ubiquitin C-terminal hydrolase
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 308 aa AA seqDB search
MNSAIQAMIHIPAVQHYLNDVNNNKIKDLKPRSVTHVLAELSKRMWMGDKKYINPKKIIQ
RLDEINCMMSEWQQEDSHEYYMSLMSRLQEDSTPKGKKLNESIIYDIFGGLLKQRITCHK
CHNVSATNQEFYDLSLGLNRKKFKNSNKFSIEKSINEFFSNELIKKTEENKSGYYCENCK
MFTHANKISTIKIAPETLTIHFKRFKFNNNSSSKVKQSINYSKFLNLSKYMEDKEEKAVY
KLISVIVHEGRSISSGHYVSHCLQPDGYTWCTYDDEYINKIEERVALNDPSAYVLVYTKL
TPKEMASE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgctattcaagcaatgatccatattccagcggtgcaacattacctcaatgat
gtcaataataataaaatcaaagatttgaagccaagatcagttactcatgttttagctgaa
ttgagtaagagaatgtggatgggggataaaaaatatatcaacccaaagaaaatcatacaa
agattggatgaaattaattgtatgatgagtgaatggcaacaagaagattcccatgaatat
tacatgtcattgatgtcaagattacaagaagattcaaccccaaagggtaagaaattgaat
gaatcgataatttatgatatatttgggggattattaaaacaaagaatcacatgtcataaa
tgtcataatgtatcagctactaatcaagagttttatgatttatctttaggattaaatcgt
aaaaaattcaagaatagtaataaattttcaattgaaaaatcaattaatgaatttttcagt
aatgaattaattaaaaaaactgaagagaataaatctggatattattgtgaaaattgtaaa
atgtttacacatgccaataaaatatccaccattaaaattgccccagaaacattaactatt
cattttaaacgattcaaattcaacaataactcaagttccaaagtcaaacaactgattaat
tattctaaatttttaaatttgagtaaatatatggaagacaaggaagaaaaagctgtatat
aaattaatttcagttattgttcatgaaggtagatcgatatctagtggtcattatgtttct
cattgtttacaaccggatggatatacttggtgtacatatgatgatgaatacatcaataag
attgaagaaagagtagcattgaatgatccatctgcatatgttttggtttatacaaaatta
accccaaaagaaatggcatcagaatag

DBGET integrated database retrieval system