KEGG   Candida tropicalis: CTRG_00485Help
Entry
CTRG_00485        CDS       T01115                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CTRG_00485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 680 aa AA seqDB search
MALDKLDLYVIITLVVAIAAYFAKNQFLDQQQDTGFLNTDSGDGNSRDILQALKKNNKNT
LLLFGSQTGTAEDYANKLSRELHSRFGLKTMVADFADYDFENFGDITEDILVFFIVATYG
EGEPTDNADEFHTWLTEEADTLSTLKYTVFGLGNSTYEFFNAIGRKFDRLLGEKGGDRFA
EYGEGDDGTGTLDEDFLAWKDNVFDSLKNDLNFEEKELKYEPNVKLTERDDLSGNDPEVS
LGEPNVKYIKSEGVDLTKGPFDHTHPFLARIVKTKELFTSEDRHCVHVEFDISESNLKYT
TGDHLAIWPSNSDENIKQFAKCFGLEDKLDTVIELKALDSTYSIPFPNPITYGAVIRHHL
EISGPVSRQFFLSIAGFAPDEETKKSFTRIGGDKQEFASKVTRRKFNIADALLFASNNRP
WSDVPFEFLIENVQHLTPRYYSISSSSLSEKQTINVTAVVEAEEEADGRPVTGVVTNLLK
NIEIEQNKTGETPMVHYDLNGPRGKFSKFRLPVHVRRSNFKLPKNSTTPVILIGPGTGVA
PLRGFVRERVQQVKNGVNVGKTVLFYGCRNSEQDFLYKQEWSEYASVLGENFEMFNAFSR
QDPTKKVYVQDKILENSALVDELLSSGAIIYVCGDASRMARDVQAAIAKIVAKSRDIHED
KAAELVKSWKVQNRYQEDVW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcattagataagttagatttatatgttattataacattggtggttgcaattgcagct
tattttgcaaagaatcagtttcttgaccaacaacaagataccgggttccttaatactgat
agtggagatggtaattcaagagatatcttacaagctttgaagaagaacaataaaaatacg
ttattattatttggatcccaaacaggtacagcagaagattatgccaacaaattgtcaaga
gaattgcattcaagatttggtttgaaaaccatggttgctgatttcgctgattatgatttc
gaaaacttcggagatattactgaagatatcttggttttctttattgttgctacttatggt
gaaggtgaaccaaccgataatgctgacgaatttcacacttggttgactgaagaagctgac
accttgagtactttgaaatatactgtttttggtttgggtaattcaacttatgaattcttc
aatgctattggtagaaaatttgacagattgttgggagaaaaaggtggtgacagatttgct
gaatacggtgaaggtgacgatggtactggtactttagatgaagatttcttggcctggaag
gataacgtgtttgattccttaaagaatgatttgaattttgaagaaaaagagttgaaatac
gaaccaaatgttaaattgactgaaagagatgatttatctggcaatgatccagaagtctcc
ttgggtgaaccaaatgtcaaatacattaaatctgaaggtgttgacttaactaaaggtcca
tttgatcatactcatccatttttggctagaattgttaaaactaaagaattgtttacttct
gaagacagacattgtgttcatgttgaatttgatatttctgaatcaaacttgaaatatacc
accggtgatcatcttgcaatctggccatctaactctgatgaaaacattaagcaatttgcc
aaatgttttggtttagaagacaaacttgatactgttattgaattgaaagctttggattcc
acttattccatcccattccctaatccaatcacttatggagctgttattagacaccatttg
gaaatttcaggtcctgtttctagacaatttttcttatctattgctggatttgcccctgat
gaagaaactaaaaagtcatttactagaattggtggtgataagcaagaatttgctagtaaa
gtcacccgtagaaaattcaacattgccgatgctttattatttgcttccaacaacagacca
tggtccgatgttccattcgaattccttattgaaaatgtccaacacttaactcctcgttat
tactccatttcttcttcctcattaagtgaaaagcaaaccattaatgttactgctgttgtt
gaagccgaagaagaagctgatggaagaccagttactggtgttgtcaccaacttgttgaag
aatattgaaattgaacaaaacaaaactggtgaaaccccaatggttcattatgatttgaat
ggtccaagaggcaaatttagcaagttcagattgccagttcacgttagaagatctaatttc
aaattaccaaagaatagcactaccccagttattttgattggtccaggtaccggtgttgca
ccattgagaggttttgttagagaaagagttcaacaagttaaaaatggtgttaatgttggt
aagactgtattgttttatggatgtagaaattccgaacaagatttcttgtacaaacaagaa
tggagtgaatatgcctcagtattgggagaaaatttcgaaatgtttaatgccttctcaaga
caagatccaactaagaaagtttatgttcaagataagattttagaaaatagtgctcttgtt
gatgagttattatctagtggagcaattatttatgtttgtggtgatgccagtagaatggct
agagatgttcaagctgcaattgccaagattgttgccaaaagtagagatatccacgaagat
aaagctgctgaattggttaaatcttggaaagttcaaaatagataccaagaagatgtctgg
taa

DBGET integrated database retrieval system