KEGG   Candida tropicalis: CTRG_00517Help
Entry
CTRG_00517        CDS       T01115                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctp  Candida tropicalis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CTRG_00517
   00052 Galactose metabolism
    CTRG_00517
   00500 Starch and sucrose metabolism
    CTRG_00517
   00520 Amino sugar and nucleotide sugar metabolism
    CTRG_00517
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CTRG_00517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 472 aa AA seqDB search
MRNALNNLADTVEDPEDKNRFENEMDNFFSLFRRYLTEKASGSTLDWEKIRSPSADEVVA
YSDLNDTDSSTNLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRK
YDADVPLLLMNSFNTDADTAKIIKKYQGHRIRVKTFNQSRFPRIYKDSLLPVPETYDDSL
EAWYPPGHGDLFEALVQSGELDALLAQGREVLFVSNGDNLGATVDTKILDHMIETGAEYI
MELTPKTRADVKGGTLINYQGEVRLLEIAQVPKEHVEEFKSIKKFKYFNTNNLWINLRAI
KKLVEANAIEAEIIPNQKSISHGKSDVNVLQLETAVGAAIRHFKGAHGVVVPRSRFLPVK
TCSDLLLVKSDLFYLEHGALRLDPTRDGFSNPLIKLGSHFKKVSGFQSRIPYIPKILELD
HLTITGNVTIGKGVQLKGTVIIVCNDGDKIDIPNGSILENVVVTGNLTILEH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgctttgaacaacttagccgacaccgttgaagatccagaagacaagaacaga
tttgaaaatgaaatggacaactttttctcccttttcagaagatacttgactgaaaaagct
tccggttccactttggattgggaaaaaatcagatctccttctgctgatgaagttgttgca
tactccgatttgaacgataccgacagctctaccaacttgtccaaattggcagtcttgaaa
ttgaatggtggtttgggtacttccatgggttgtgttggtcctaaatccgtcattgaagtc
agagatggaaacacttttttggatttgtccgtcagacaaattgaatatttgaacagaaaa
tacgacgctgatgtcccattgttgttgatgaactcttttaacactgatgccgatactgcc
aaaatcatcaagaaataccaaggtcacagaatcagagtcaagactttcaaccaatccaga
ttcccaagaatttataaggattctttattaccagtcccagaaacttatgacgattctctt
gaagcttggtatccaccaggtcacggtgacttgtttgaagctttggttcaatctggtgaa
ttggatgccttattagctcaaggtagagaagttttgtttgtttccaatggtgataacttg
ggtgccactgttgataccaagattttggaccatatgattgaaactggtgctgaatatatt
atggaattgaccccaaaaacaagagccgatgttaaaggtggtactttgatcaactaccaa
ggtgaagtcagattattggaaattgctcaagttccaaaagaacacgttgaagaattcaag
agtatcaagaaattcaaatatttcaacaccaacaacttgtggatcaacttgagagccatc
aagaaattggttgaagccaatgccattgaagctgaaatcattccaaatcaaaaatccatt
tctcatggtaaatcagatgtcaacgttttacaattagaaactgccgttggtgctgctatt
agacatttcaaaggtgcccatggtgttgttgttccaagatcaagattcttgccagttaaa
acctgttccgatttgttgttagttaaatccgatttgttctatttggaacacggtgcttta
agattagacccaactagagatggtttctctaacccattgatcaaattaggatctcatttc
aaaaaagtcagtggattccaatctagaattccttacattccaaagattttagaattagat
cacttgaccattactggtaacgttactattggtaagggtgtccaattgaaaggtactgtc
atcattgtgtgtaatgatggtgataagatcgatattccaaatggttctattttggaaaat
gtcgtggttactggtaacttgactatcttggaacattaa

DBGET integrated database retrieval system