KEGG   Candida tropicalis: CTRG_00564Help
Entry
CTRG_00564        CDS       T01115                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ctp  Candida tropicalis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CTRG_00564
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CTRG_00564
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTRG_00564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MPRRSSNAPSIPVVATIDIGTTSARAIIFSREGEELAKHQIEYSTTASEAPDSSSNTDQF
RRRSSLMRQNEPIFSAEGIAISINDNVMIENNHSSVGPTLRFPQPGWVECMPVHILANAV
QCLVACLITLRKINQNPNLKLKYRVKAIGIANMRETTIVWSRKTGKPLSGGITWTDTRTA
EIVQHLEKMIDEDRKAELKEKTGLPLSTYFSAAKLRWLLDNDDVIREEYEKGDGNLMFGT
VDTWLIYHLTKEKTYVSDITNASRTYFMDLETLDWDDELLDFWGIDPTRIRFPKIVSSSE
FYGEFAAPNLSNLGFHNKITQEAYDILKTITGVPICGCLGDQSASLVGQLAFTSGSAKCT
YGTGAFLLYNTGPRKLISKQGALTTFGYWFPTLEGNEGKPHYALEGSIAVAGSIIQWLRD
NLKMIDNAKDIGPLASQVENSGGVVFIPAFSGLYAPYWDSGSRGTIFGMTQYTSASHIAR
AALEGVCFQVRAILKAMASDAGASEDFLEESLCCQGSSRPLSSLATDGGMSKADEVLQIQ
ADILGPCVTVTRALTPECTALGAAIAAGLSFENEEDRIWKDLDDVVEKITGGASGKTGNK
FVAELPDDTRRKNWKRWEKAIERAKSWLDDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcgtagtagtaatgctccttctataccagtggtcgcaaccatcgatattggt
accacttcagcaagagcaatcattttctcaagagaaggtgaagaattagctaagcatcaa
attgaatactccactactgcttcagaagcacctgattcctcgtcaaacactgaccaattc
agaagaagatcgtctttaatgagacaaaatgaacctattttctcggctgaaggtattgct
atctccatcaatgataacgttatgatcgaaaacaaccattcctcggttggtccgacttta
agattccctcaacctggttgggttgaatgtatgcctgttcatatcttggccaatgctgtt
caatgtttggttgcttgtttgatcacattgagaaaaattaaccaaaatcctaatttgaag
cttaaatatagagttaaagctattgggattgccaatatgagagaaaccactattgtttgg
tccagaaaaactggtaagccattaagtggtggtatcacttggactgatactagaactgcc
gaaattgttcaacatttagaaaaaatgattgatgaagatagaaaagctgaattgaaagaa
aaaacaggtttgccattgtcaacttatttctcagctgctaaattgagatggttattggat
aatgatgatgtcatcagagaagaatatgaaaagggtgacggtaatttaatgtttggtact
gttgatacctggttgatttaccatttaactaaagaaaaaacctacgtttctgatatcact
aatgcatcaagaacttattttatggatttggaaactttagattgggatgatgaattatta
gatttctggggtattgatccaactagaatcagattcccaaaaatcgtctcatcttctgaa
ttctatggtgaatttgctgccccaaatttgtccaacttgggattccataataaaatcacc
caagaagcatatgatattttgaaaaccataactggtgttccaatttgtggttgtcttggt
gatcaatcagcctccttggtaggtcaattggccttcacttctggttctgctaaatgtact
tatggtactggtgctttccttttgtacaacactggtccacgtaagttgattagtaaacaa
ggggcattgactacttttggttattggttcccaacattagaaggaaatgaaggtaaacct
cattatgctttggaaggttctattgctgttgctgggtccattattcaatggttgagagat
aacttgaaaatgattgataatgccaaggacattggtccattggcttctcaagttgaaaat
tctggtggagttgtgtttattccagcattctcggggttgtatgctccatattgggatagt
ggttctcgaggtactatatttggtatgactcaatacacttcagcctctcatattgctcgt
gctgcattggaaggggtttgtttccaagtacgtgccattttaaaagctatggctagtgat
gctggtgcgtctgaagatttcttggaagaatcattatgttgtcaaggtagtagcagacct
ttatcttcattggccactgatggtggtatgtccaaagcagacgaagtcttacaaattcaa
gcagatattttagggccttgtgttacagttactcgtgcattaactcctgaatgtactgct
ttaggtgctgctattgctgctggtttatcatttgaaaatgaagaagatcgtatatggaag
gatcttgacgatgtggttgaaaaaatcactggtggagccagtggtaaaactggcaacaag
tttgttgctgaattacctgatgatacgagaagaaagaattggaaacgttgggaaaaggca
atcgaaagagccaagagctggttagatgatgagtaa

DBGET integrated database retrieval system