KEGG   Candida tropicalis: CTRG_00586Help
Entry
CTRG_00586        CDS       T01115                                 

Definition
TFIIH basal transcription factor complex subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ctp  Candida tropicalis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CTRG_00586
  Replication and repair
   03420 Nucleotide excision repair
    CTRG_00586
Transcription machinery [BR:ctp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CTRG_00586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MSAHLFKATVNEYLEGLPKTVQSKLYEAPATCLSIFRLLSPMAKFYIMSMIFNEKPIALR
DLDKWCKPSARKLEFEALKRLESLHLIEYDSKGSHIRLHSTFRKNFRDCLTGSQNPNAFG
SISTTADKYKVDIAFLDNFASSKWETILHFMVGTEATATPSDSVLSLLKLGGLMEGPNNK
LRITNSGFQFLLQDVNAQIWTLLLQYLNLTQELNMDPVDVLNFIFVLGSLELGKSYAVST
LSETQVSMLADLKDYGLVYQRSDTSGRFYPTRLATTLTSDSAALKTPAMAMDEEEQQVVT
KESIIIETNFKLYAYTKSPLEIAILNLFVQLKTRFANMVCGQITRESIRNALYNGITADQ
IIKFLETHAHSQMRILAKEKLDKKIEFDTSHNINTAGGAPQSKTDGSISQHKLEILPPNV
VDQIKLWQLELDRIQTFDGYLFKDFANQQEYDILSNYASELGVLIWADKVKRKFFVTKDG
MTQVADFANRKLKR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacatttgttcaaagccacagttaatgagtacctagagggtcttcccaagaca
gtgcaatctaaattgtatgaggcacctgcaacctgtttatctattttcagattactttcg
cccatggccaaattctatattatgtccatgatctttaatgaaaaaccaattgcattacgt
gatctcgacaaatggtgcaaaccactggcgagaaaactagaatttgaagcgttgaaaaga
ttagaatcattacatttgatagaatatgatagtaaaggttctcatattcgattgcattca
acatttcgaaagaatttccgtgattgtttaacgggttcacagaatcctaatgcttttgga
agtattagcactacagctgataaatataaagttgatattgcattcttggataattttgca
tcactgaaatgggaaaccattttacatttcatggttggtactgaagccacagctactcct
tctgattcagtgttgagtttacttaaattgggtggattaatggagggtcctaataataaa
cttagaattacaaatagtgggtttcagtttttattacaagatgtgaatgcacaaatatgg
acattgttgttacaatatttaaatttaactcaggagttaaacatggatccagttgatgtt
ttgaattttatttttgttttgggatctttagaattaggtaagagttatgcagtatccact
ttaagtgaaacccaagttagtatgttggcagatttgaaagattatgggttggtatatcaa
cgatctgatacatctggaagattctatccaactagattggcaactactttaacatcggat
tcagctgccttgaaaactcctgcaatggctatggatgaagaggaacaacaagttgtaacc
aaagaatccatcattatagaaacaaatttcaaactatatgcatatacaaaatcaccattg
gaaattgcaattttgaatttatttgttcaattaaaaaccagatttgccaatatggtctgt
ggacaaattacaagagaatcaattcgaaatgcattatataatggtataactgcagatcaa
atcatcaaatttttggagactcatgctcatagtcaaatgagaattttggctaaagaaaaa
ttggataagaaaattgaattcgataccagtcataatatcaatactgccggtggtgctcca
caaagtaaaactgatggatctatttctcaacacaagttagaaattctacctccaaacgtg
gttgatcagattaaattatggcaattagaacttgatagaattcaaacatttgatggttat
ttatttaaagattttgccaatcaacaagaatatgatatattgtccaattatgcatctgaa
ttgggtgtattgatatgggcagataaagtaaaaagaaaattctttgtgacaaaagatggt
atgactcaagtggctgattttgccaacaggaaattaaaaagatag

DBGET integrated database retrieval system