KEGG   Candida tropicalis: CTRG_00656Help
Entry
CTRG_00656        CDS       T01115                                 

Definition
(RefSeq) similar to ubiquitin-specific protease.
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CTRG_00656
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_00656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1308 aa AA seqDB search
MSSENYKDFSSSSCSTSNPDNQIDNDSDDESPVSVQTNNSPENPPNQFHSNNPFRSSASA
ISESSHESTPVSQPPPPPKRQPEPQHLRTKIPNQELLKYPFKTLNRILDDLKWTVPVKEM
YNFSLLNSKPIDYSEELSRVVDSSILPFDTLILNNDVDYCKSVEKLEFPDTQQVLYIMRG
LLSDKKKKVYHFRILALETNSNPFVTKIIDKHNYHVIPKSRVSDHDLKLLQDDSNEFESI
IDDSFYRSLNSPNGQILRVTLFDSEFSKEDLIPLTDEKIIKERYLEGVERHPNLSPETIP
NSTHCIKTLIKVLKGPVMLKSSDIIKTISLKNTVMDAQIDVNLLFDKLSFTSNGDEVVPP
NLNESHGLRESYIRKILELIYFAKNLSVSSNEFQSQYSFSENMSQIFNTIVEFDKHTSVT
NFSSNYSNRFPFFINLSASAYFPDELIIKCFELTVQSDRANSLYYVDSLKQIRNFRHSSS
NGYSNTKLDSYFRQHELIGFSDYLESMKIIGLAVENNDIDSIDDDVIIAMYRTQIKNDSR
NYQYFNDHLRKIAKIKNSEKLTDFIHEELLPESLALEELSIEEITEDDVVITAYEFKLDD
LLQRNGFNTESNEVVLLNKALLSVAVYRKSFILLNYLETKLPDCVKIPAMDDLTIHKAYE
LLGINNKANESEIINAFQTKSVKESDVRLLRSAFRLIAEFKKSEILFSFIKTGKIDTSLL
PAENWPAGLDNIGNTCYLNSLLQYYFCIKPLRDLILTFNENDYKSDDYSEDRKVGGRKVE
KSEVQRSSQFIYQLRRLFEEMIYSNQRCVEPNKELAYLSFLPLSQPVNFRQHEKSTKSTE
ATEANVIEVKIDEDDDNNLIIEHKEEQTGLPSAADDTGNANDVTMIDEETEPVTNAGGSY
DDAILVDMGEGTPQPPTLPPREQNGDNNDDVDDDDEELETPGTSSDDDHNLSLPKILPIS
TDQIESTIEVGRQQDVTECIENVIYQIETALPPESLDKDGEQYDLIKKLFYGKTKQTITP
LDKSLKSRVSFERFFSLIINVSDHPKSIYDALDYYFNDDIVKLEEGLVKKSITISELPQI
LQFHVQRVMFDRERLMAYKSIEPIPFSDKIYLDRYLDTDDEEILSKRNQVFEWKKEIKQL
QDEKAKLLKTDEDTSLNIIDNLKITKKYLEKRIILDDSLSIDLTTIQIIQSEIDNLSSKL
LTIDSQIEKINHSINNQFTDYKEVCYDIFAIFIHRGEASYGHYWIYIKDPHNRDIFRKYN
DEIVTEVPSSEVFNFLETNTATPYYIVYVKDELELNYIEPLKREIKQT
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgagaattacaaggatttttcatcgtcatcctgttccacaagtaatcctgat
aaccagattgacaacgattcagacgatgaatcaccagtttcagtacaaacaaataattct
ccagaaaacccaccaaatcaattccattcaaataatccattcagatcttctgcatcagca
atatcggaatcgtctcatgaatcaacacctgtatcacaaccaccaccaccaccgaaacga
caaccagaaccgcaacatttgcgcacaaagatcccaaatcaagaattattaaagtatcct
tttaaaaccttgaatagaatattggatgatttgaaatggacagttcccgtgaaggaaatg
tacaacttcagcttgttgaatagtaagccaattgactattctgaagagctaagtagagtg
gtcgattcatctattttaccatttgatacgttgattctcaacaatgatgtcgattattgc
aaatccgttgagaaattggaatttcctgacacacaacaagtattgtatatcatgagagga
ttattactggataaaaaaaagaaagtttatcactttcgaattcttgctctcgaaacaaat
tcaaacccttttgttactaagattatcgacaagcataattatcatgtgattccaaaaagc
agagtttcggatcatgacttgaagttgttgcaagatgattcgaacgaatttgagagtatt
attgatgacagtttttataggagtttgaactcgccaaatggtcaaattttaagggtgact
ttgtttgacctggaattttctaaagaagatttaattcctttgactgacgaaaagataatc
aaagaaagatacttggagggtgttgaaaggcatcctaatttgtctcctgaaacaatccca
aattctactcattgcattaaaaccttgatcaaagtattgaaaggtcctgttatgttgaaa
tcactggatattattaaaaccattagtctcaagaacacagtgatggacgcacagattgat
gttaatttgttatttgataaattgtcattcactctgaatggtgacgaggttgttcctcct
aatttgaacgagtcccatggattaagagaatcgtatattagaaaaattctagagttgatt
tattttgcaaagaatcttctggtatcttccaatgaattccaaagtcagtattcattttca
gagaatatgtcacaaattttcaatactattgtcgaatttgacaaacacaccagtgttacc
aacttcagtagcaattattcaaacaggttcccattcttcatcaaccttagtgcatctgct
tactttccggatgaattaatcataaaatgcttcgagttaacagtacaatcagatagagct
aatagtctttactatgtcgattctttgaagcagattcgtaatttccgccacagtagcagc
aacgggtattccaataccaaacttgatagctattttaggcaacatgagttgattggattt
agtgattaccttgaatccatgaagattatagggttggcagttgaaaataacgacattgac
tcaatcgatgacgacgtgattattgccatgtaccgaacacaaattaagaatgattcaaga
aactatcaatatttcaatgatcatttgagaaaaattgctaaaatcaaaaattccgagaaa
ctcacagacttcatacatgaagagttgttgcctgagagtttagcacttgaggagttatct
attgaagaaataactgaagatgacgtggttataactgcatacgaattcaaattggatgat
cttttgcaacgcaatggatttaatactgagtccaatgaggttgtgttgttaaataaagct
ttgttatcggtagcagtttatcgaaagagttttatcttattgaattatttggaaaccaaa
ttgcctgattgcgtgaaaataccagcaatggatgatcttactattcacaaggcctatgaa
ttacttggaatcaacaataaagccaacgaatcggagattattaatgcattccagacaaaa
tcagttaaggaatcggatgtacggttgttaagaagtgcattccgtttaatcgcagaattt
aaaaaatcagaaatcctatttagttttatcaaaacaggtaaaattgatacatctttgtta
cctgctgaaaattggccagcaggtttggataatattgggaatacttgttatttaaattca
ttgttacaatattacttctgtatcaaaccgttaagagatttaattttgactttcaatgaa
aatgattacaaatcagatgattattctgaagatagaaaagttgggggtagaaaagttgag
aaatctgaagttcaaagatcgagccaatttatttaccaattacgtcgtttgtttgaagaa
atgatttatagtaatcaaagatgtgttgaaccaaacaaagaactagcatacttatctttc
cttccattatcgcaaccagtcaactttagacaacatgaaaaatcaacaaagagtaccgag
gcaacagaagctaatgtaattgaagtcaagattgatgaggatgatgacaataatttaatt
attgagcataaagaagagcaaacaggtttaccatcagcagcagatgatactggcaatgcc
aacgatgttacaatgattgatgaagaaactgagcctgttaccaatgctggtggttcatat
gacgatgcaattcttgttgacatgggcgagggtactcctcaaccaccaacattaccaccc
cgtgaacaaaacggtgacaataacgatgatgttgacgatgatgacgaagaattggaaact
ccgggtacttctagtgacgatgatcataatctttcacttccaaaaatactaccaattctg
actgatcaaatagaaagcacaatcgaggttggtagacaacaagatgttactgaatgtatt
gaaaatgttatctaccaaattgaaacagcgttgccaccagaatctttggataaagatgga
gaacaatatgatttgattaagaaattgttttatggtaaaacaaagcaaacaattactcca
ttagacaagtccttgaagagtcgtgtttcctttgaaagattttttagtttgattattaat
gttagtgatcatccaaagagtatttatgatgcattagattattatttcaatgatgatatt
gtgaagttagaagaaggattagttaaaaagagtataactattctggaattgccacaaatt
cttcaattccatgtacagagagttatgtttgatagagagagactaatggcatataaatcc
attgaaccaattccgttcagtgataagatttatttggatagatatttagacactgatgat
gaagaaattcttagcaagagaaaccaagtgtttgaatggaaaaaagaaattaaacaatta
caagatgaaaaggctaaattattgaaaaccgatgaagacacttctttgaatataattgat
aatttgaaaatcacaaagaaatatcttgaaaaaagaatcattcttgatgattcattaagt
attgatttaacaaccattcaaattattcaactggaaattgataatttatcatctaaatta
cttacaatagattctcaaattgaaaagattaatcatctgataaataatcaatttacagat
tacaaagaggtttgttatgatatatttgcaattttcattcatagaggagaagcaagttat
ggacattattggatttatattaaagatccccataatagggatattttcagaaaatataat
gatgaaattgttactgaagttccaagtagtgaagttttcaatttcttagaaaccaatacg
gctactccttattacattgtttatgttaaagatgaattagaattgaattatatagagcca
ttaaagagagaaatcaaacaaacttga

DBGET integrated database retrieval system