KEGG   Candida tropicalis: CTRG_00659Help
Entry
CTRG_00659        CDS       T01115                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 376 aa AA seqDB search
MARLPDVKESRQVVFNISQNFKVIKILGEGAYGIVALAVHIPTGTKVAIKKIEPFERPLF
CLRTLREIKLLNKFKCHENIIRLYDVQKPLDYAHFNEVYLIQEYMPSDLHNIIYTHVLSD
QHVQYFIYQILKGLKLMHSAKVIHRDLKPSNILVNEQCDLKICDFGLARLDAKHYNLETN
PKISMLTEYVATRWYRAPEIMLSASNYSTAIDLWSVGCILAELLTYKALFPGTDYINQLR
LIFEVLGSPSDEDLKIIKSERAQKFVKSLPYRVKIDLTDFVNNHPYRRIKVRARETVNPL
AIDLLEKLLVFDPSKRITVQEALEHPYLEAYHDPSHEPITSPIPVEEFEFDMDKKQLDVE
DLKQQIYKQIMATNQI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggctagacttccagatgtaaaagaaagtcgtcaggtggtattcaatatttcccaaaac
ttcaaggttataaagatacttggtgaaggtgcatatggaattgttgcattggcagttcat
attcctacaggaacaaaagttgccatcaagaaaatcgaaccctttgaaagaccattgttc
tgtcttcgtactttaagagagataaaactattaaacaaattcaaatgtcatgaaaatata
attagattgtatgatgttcaaaaaccattagattacgctcattttaatgaagtttatctt
atccaagaatacatgccactggatttacacaatataatttacactcatgttttaagtgat
caacatgtccaatatttcatttatcaaatcttaaaaggtttaaaattgatgcatagcgcc
aaagtcattcatcgtgatttaaagccatcaaatatccttgtcaatgaacaatgtgatttg
aaaatttgcgattttggattagctagattagatgctaaacattataatttagaaacaaac
cccaaaatctccatgttgactgagtatgttgccactagatggtatagagctccagaaatc
atgttgagtgcatctaattattctaccgcgattgatctttggtcagttggttgtatttta
gcagaattattaacctataaagctttatttccaggaactgattatataaatcaattacgt
ttaatttttgaagttttgggtagtccaagtgacgaagatttaaagattataaaatcagaa
agagcacaaaaatttgttaaatcattaccatatagagttaagattgatcttactgatttt
gttaataatcatccctatagacgaatcaaagttcgtgcaagagaaactgtaaatccattg
gcaattgatttgttggaaaaattgttagtatttgacccttcaaaaagaataacagtccaa
gaagcattagaacatccatatttagaggcttatcatgatccatctcatgaaccaatcacc
ctgccaataccagtggaagaatttgagtttgacatggacaaaaaacagttggatgttgaa
gatttgaaacagcaaatctataagcaaatcatggcaactaatcaaatttga

DBGET integrated database retrieval system